Comparing CA265_RS12370 FitnessBrowser__Pedo557:CA265_RS12370 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6eb3C Structural and enzymatic characterization of an esterase from a metagenomic library
27% identity, 87% coverage: 39:290/291 of query aligns to 3:257/262 of 6eb3C
6eb3A Structural and enzymatic characterization of an esterase from a metagenomic library
27% identity, 87% coverage: 39:290/291 of query aligns to 3:260/265 of 6eb3A
6eb3B Structural and enzymatic characterization of an esterase from a metagenomic library
26% identity, 87% coverage: 39:290/291 of query aligns to 3:263/268 of 6eb3B
2d0dA Crystal structure of a meta-cleavage product hydrolase (cumd) a129v mutant (see paper)
26% identity, 81% coverage: 44:280/291 of query aligns to 12:258/271 of 2d0dA
1iunB Meta-cleavage product hydrolase from pseudomonas fluorescens ip01 (cumd) s103a mutant hexagonal (see paper)
35% identity, 38% coverage: 44:155/291 of query aligns to 13:127/276 of 1iunB
Sites not aligning to the query:
1ukaA Crystal structure of a meta-cleavage product hydrolase (cumd) complexed with (s)-2-methylbutyrate (see paper)
26% identity, 81% coverage: 44:280/291 of query aligns to 12:258/271 of 1ukaA
1uk9A Crystal structure of a meta-cleavage product hydrolase (cumd) complexed with isovalerate (see paper)
26% identity, 81% coverage: 44:280/291 of query aligns to 12:258/271 of 1uk9A
1uk8A Crystal structure of a meta-cleavage product hydrolase (cumd) complexed with n-valerate (see paper)
26% identity, 81% coverage: 44:280/291 of query aligns to 12:258/271 of 1uk8A
1uk7A Crystal structure of a meta-cleavage product hydrolase (cumd) complexed with n-butyrate (see paper)
26% identity, 81% coverage: 44:280/291 of query aligns to 12:258/271 of 1uk7A
1iupA Meta-cleavage product hydrolase from pseudomonas fluorescens ip01 (cumd) s103a mutant complexed with isobutyrates (see paper)
26% identity, 81% coverage: 44:280/291 of query aligns to 12:258/271 of 1iupA
2xuaH Crystal structure of the enol-lactonase from burkholderia xenovorans lb400 (see paper)
27% identity, 55% coverage: 39:197/291 of query aligns to 3:155/261 of 2xuaH
Sites not aligning to the query:
4nvrA 2.22 angstrom resolution crystal structure of a putative acyltransferase from salmonella enterica
32% identity, 38% coverage: 43:154/291 of query aligns to 23:138/302 of 4nvrA
Sites not aligning to the query:
P22862 Arylesterase; Aryl-ester hydrolase; Carboxylic acid perhydrolase; PFE; Putative bromoperoxidase; EC 3.1.1.2; EC 1.-.-.- from Pseudomonas fluorescens (see 5 papers)
27% identity, 54% coverage: 37:192/291 of query aligns to 2:162/272 of P22862
Sites not aligning to the query:
3ia2A Pseudomonas fluorescens esterase complexed to the r-enantiomer of a sulfonate transition state analog (see paper)
27% identity, 54% coverage: 37:192/291 of query aligns to 1:161/271 of 3ia2A
Sites not aligning to the query:
8pi1B Bicyclic incypro pseudomonas fluorescens esterase (see paper)
27% identity, 54% coverage: 37:192/291 of query aligns to 1:161/276 of 8pi1B
5jzbA Crystal structure of hsad bound to 3,5-dichlorobenzene sulphonamide (see paper)
26% identity, 80% coverage: 40:272/291 of query aligns to 12:263/282 of 5jzbA
Sites not aligning to the query:
P9WNH5 4,5:9,10-diseco-3-hydroxy-5,9,17-trioxoandrosta-1(10),2-diene-4-oate hydrolase; 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase; HOPDA hydrolase; Meta-cleavage product hydrolase; MCP hydrolase; EC 3.7.1.17; EC 3.7.1.8 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
26% identity, 80% coverage: 40:272/291 of query aligns to 18:269/291 of P9WNH5
3r3xA Crystal structure of the fluoroacetate dehalogenase rpa1163 - asp110asn/bromoacetate (see paper)
31% identity, 41% coverage: 36:154/291 of query aligns to 9:131/293 of 3r3xA
Sites not aligning to the query:
5t4tA Crystal structure of the fluoroacetate dehalogenase rpa1163 - asp110asn - apo no halide (see paper)
31% identity, 41% coverage: 36:154/291 of query aligns to 13:135/301 of 5t4tA
Sites not aligning to the query:
3r3wA Crystal structure of the fluoroacetate dehalogenase rpa1163 - asp110asn/chloroacetate (see paper)
31% identity, 41% coverage: 36:154/291 of query aligns to 9:131/295 of 3r3wA
Sites not aligning to the query:
>CA265_RS12370 FitnessBrowser__Pedo557:CA265_RS12370
MKNLFKTQYLLKTILLIAIMMVIVAQSNAQQGKPNGSGFVPVNGIKVYYETYGQGKPVIL
LHGAFMTIEANWGQLIPQLSKTRKVIAIELQGHGHSPFSDRKLSHVTLASDVAGVMDYLK
IDSADVIGYSFGGSVAYQFAIQSPKRLGKLVIISSTYKSAGWMPEVNNAFKSMKPELFMN
SPMHVAYDAVAPDKTKWTKFLEQMIALAGEPYNMGDNNISKITSPVLIIAGDNDGLDKME
LIKTYQLLGGAIFADFGAMPKSQLAIVPSQGHVSLMQQTQTIFGYLDSFLK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory