SitesBLAST
Comparing CA265_RS14780 FitnessBrowser__Pedo557:CA265_RS14780 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q5KUG0 Fused isobutyryl-CoA mutase; EC 5.4.99.13; EC 3.6.5.- from Geobacillus kaustophilus (strain HTA426) (see paper)
63% identity, 100% coverage: 6:1129/1129 of query aligns to 4:1086/1086 of Q5KUG0
- K213 (= K209) mutation to A: Loss of GTPase and ATPase activities. No effect on the mutase activity.
Q1LRY0 Fused isobutyryl-CoA mutase; EC 5.4.99.13; EC 3.6.5.- from Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) (Ralstonia metallidurans) (see 2 papers)
61% identity, 99% coverage: 9:1129/1129 of query aligns to 23:1093/1093 of Q1LRY0
- H39 (= H25) binding axial binding residue
- 169:417 (vs. 155:398, 57% identical) GTPase chaperone MeaI
- GAGKSS 219:224 (= GAGKSS 206:211) binding
- S223 (= S210) binding
- I248 (≠ V234) binding
- D249 (= D235) binding
- D262 (= D248) binding ; binding
- R265 (= R251) binding
- E310 (= E296) binding ; binding
- T311 (= T297) binding
- NKFD 357:360 (= NKFD 343:346) binding
- 418:579 (vs. 399:571, 35% identical) Linker
- F587 (≠ L579) binding
- F598 (= F590) mutation to A: Switches the substrate specificity and enhances the catalytic efficiency of the isovaleryl-CoA mutase over the native isobutyryl-CoA mutase activity about 4000-fold. Is even more susceptible to inactivation than wild-type during turnover.
- R622 (= R614) binding
- R728 (= R764) binding
- Y772 (= Y808) binding
- S821 (= S857) binding
- R856 (= R892) binding
- K861 (= K897) binding
- E973 (= E1009) binding
- N1092 (= N1128) binding
4xc6A Isobutyryl-coa mutase fused with bound adenosylcobalamin, gdp, and mg (holo-icmf/gdp) (see paper)
60% identity, 99% coverage: 9:1129/1129 of query aligns to 3:1067/1067 of 4xc6A
- active site: K6 (= K12), F572 (= F590), Y753 (= Y815), H754 (= H816)
- binding cobalamin: G18 (= G24), H19 (= H25), D20 (= D26), A21 (= A27), S22 (≠ T28), M26 (= M32), Y66 (= Y72), Q67 (= Q73), G94 (= G100), G96 (= G102), V98 (= V104), Y116 (= Y122), S117 (= S123), P118 (= P124), M129 (= M135), F601 (= F619), L606 (= L624), S624 (= S642), Q716 (= Q778), H754 (= H816), E757 (= E819), A758 (= A820), G842 (= G904), R843 (= R905), E879 (= E941), A880 (= A942), T882 (= T944), H967 (= H1029)
- binding guanosine-5'-diphosphate: G199 (= G206), G201 (= G208), K202 (= K209), S203 (= S210), S204 (= S211), R245 (= R251), N337 (= N343), K338 (= K344), D340 (= D346), Q375 (≠ M381), S377 (= S383), E947 (= E1009)
- binding magnesium ion: S203 (= S210), D229 (= D235), D242 (= D248), D242 (= D248), E290 (= E296), E290 (= E296)
5cjwA Isobutyryl-coa mutase fused with bound adenosylcobalamin, gdp, mg (holo-icmf/gdp), and substrate pivalyl-coenzyme a (see paper)
60% identity, 99% coverage: 9:1129/1129 of query aligns to 3:1063/1063 of 5cjwA
- active site: K6 (= K12), F571 (= F590), Y752 (= Y815), H753 (= H816)
- binding pivalyl-coenzyme A: F558 (= F577), F560 (≠ L579), R562 (= R581), R569 (= R588), F571 (= F590), R595 (= R614), S650 (= S669), T652 (= T671), R701 (= R764), T703 (= T766), Q705 (= Q768), Y745 (= Y808), Y752 (= Y815), H753 (= H816), S794 (= S857), F796 (= F859), R829 (= R892), K834 (= K897), H836 (= H899)
- binding cobalamin: G18 (= G24), H19 (= H25), D20 (= D26), A21 (= A27), S22 (≠ T28), M26 (= M32), Y66 (= Y72), Q67 (= Q73), G94 (= G100), G96 (= G102), V98 (= V104), Y116 (= Y122), S117 (= S123), P118 (= P124), F600 (= F619), L605 (= L624), S623 (= S642), Q715 (= Q778), H753 (= H816), E756 (= E819), A757 (= A820), G841 (= G904), R842 (= R905), E878 (= E941), A879 (= A942), T881 (= T944), H966 (= H1029)
- binding guanosine-5'-diphosphate: G199 (= G206), G201 (= G208), K202 (= K209), S203 (= S210), S204 (= S211), R245 (= R251), N337 (= N343), K338 (= K344), D340 (= D346), Q375 (≠ M381), S377 (= S383), N1062 (= N1128)
- binding magnesium ion: S203 (= S210), D229 (= D235), D242 (= D248), D242 (= D248), E290 (= E296), E290 (= E296)
5cjtA Isobutyryl-coa mutase fused with bound adenosylcobalamin, gdp, mg (holo-icmf/gdp), and substrate isobutyryl-coenzyme a (see paper)
60% identity, 99% coverage: 9:1129/1129 of query aligns to 3:1062/1062 of 5cjtA
- active site: K6 (= K12), F569 (= F590), Y750 (= Y815), H751 (= H816)
- binding cobalamin: G18 (= G24), H19 (= H25), D20 (= D26), A21 (= A27), S22 (≠ T28), M26 (= M32), Y66 (= Y72), Q67 (= Q73), G94 (= G100), G96 (= G102), V98 (= V104), Y116 (= Y122), S117 (= S123), F598 (= F619), L603 (= L624), S621 (= S642), Q713 (= Q778), H751 (= H816), E754 (= E819), A755 (= A820), G839 (= G904), R840 (= R905), E876 (= E941), A877 (= A942), T879 (= T944), H964 (= H1029)
- binding isobutyryl-coenzyme a: F556 (= F577), F558 (≠ L579), R560 (= R581), R567 (= R588), F569 (= F590), R593 (= R614), S648 (= S669), T650 (= T671), R699 (= R764), T701 (= T766), Q703 (= Q768), Y743 (= Y808), Y750 (= Y815), H751 (= H816), S792 (= S857), F794 (= F859), R827 (= R892), K832 (= K897), H834 (= H899)
- binding guanosine-5'-diphosphate: G199 (= G206), G201 (= G208), K202 (= K209), S203 (= S210), S204 (= S211), R245 (= R251), N336 (= N343), K337 (= K344), D339 (= D346), Q374 (≠ M381), S376 (= S383), E944 (= E1009)
- binding magnesium ion: S203 (= S210), D229 (= D235), D242 (= D248), D242 (= D248), E289 (= E296), E289 (= E296)
5cjvA Isobutyryl-coa mutase fused with bound adenosylcobalamin, gdp, mg (holo-icmf/gdp), and substrate isovaleryl-coenzyme a (see paper)
60% identity, 99% coverage: 9:1129/1129 of query aligns to 3:1061/1061 of 5cjvA
- active site: K6 (= K12), F569 (= F590), Y750 (= Y815), H751 (= H816)
- binding cobalamin: G18 (= G24), H19 (= H25), D20 (= D26), A21 (= A27), S22 (≠ T28), M26 (= M32), Y66 (= Y72), Q67 (= Q73), G94 (= G100), G96 (= G102), V98 (= V104), Y116 (= Y122), S117 (= S123), M129 (= M135), F598 (= F619), L603 (= L624), S621 (= S642), Q713 (= Q778), E754 (= E819), A755 (= A820), G839 (= G904), R840 (= R905), E876 (= E941), A877 (= A942), T879 (= T944), H964 (= H1029)
- binding guanosine-5'-diphosphate: G199 (= G206), G201 (= G208), K202 (= K209), S203 (= S210), S204 (= S211), R245 (= R251), K336 (= K344), D338 (= D346), Q373 (≠ M381), S375 (= S383), E944 (= E1009)
- binding Isovaleryl-coenzyme A: F556 (= F577), F558 (≠ L579), R560 (= R581), R567 (= R588), F569 (= F590), R593 (= R614), S648 (= S669), T650 (= T671), R699 (= R764), T701 (= T766), Q703 (= Q768), Q713 (= Q778), Y743 (= Y808), H751 (= H816), S792 (= S857), F794 (= F859), K832 (= K897), H834 (= H899)
- binding magnesium ion: S203 (= S210), D229 (= D235), D242 (= D248), D242 (= D248), E288 (= E296), E288 (= E296)
4xc7A Isobutyryl-coa mutase fused with bound butyryl-coa and without cobalamin or gdp (apo-icmf) (see paper)
60% identity, 99% coverage: 9:1129/1129 of query aligns to 2:1053/1053 of 4xc7A
- active site: K5 (= K12), F566 (= F590), Y747 (= Y815), H748 (= H816)
- binding Butyryl Coenzyme A: F553 (= F577), R557 (= R581), R564 (= R588), F566 (= F590), R590 (= R614), S645 (= S669), T647 (= T671), R696 (= R764), T698 (= T766), Y740 (= Y808), S789 (= S857), F791 (= F859), R824 (= R892), K829 (= K897), H831 (= H899)
6oxdA Structure of mycobacterium tuberculosis methylmalonyl-coa mutase with adenosyl cobalamin (see paper)
30% identity, 50% coverage: 564:1126/1129 of query aligns to 73:566/736 of 6oxdA
- active site: Y100 (≠ F590), Y254 (= Y815), H255 (= H816)
- binding cobalamin: Y100 (≠ F590), L130 (≠ S621), H133 (≠ L624), A150 (≠ S642), R218 (≠ Q778), E258 (= E819), G344 (= G904), W345 (≠ R905), E381 (= E941), A382 (= A942), A384 (≠ T944), L385 (≠ T945)
- binding Itaconyl coenzyme A: Y86 (≠ F577), T88 (≠ L579), M89 (≠ K580), Q93 (≠ E584), T96 (= T587), R98 (= R588), Y100 (≠ F590), S175 (= S669), T177 (= T671), T206 (= T766), R218 (≠ Q778), H255 (= H816), R294 (≠ N855), S296 (= S857), F298 (= F859), R337 (≠ K897), T338 (≠ Y898), H339 (= H899), Q341 (= Q901), Q372 (≠ N932)
Sites not aligning to the query:
- active site: 610, 614, 616
- binding cobalamin: 615, 616, 617, 618, 661, 663, 665, 691, 692, 711, 712, 715
8dyjB Crystal structure of human methylmalonyl-coa mutase in complex with adp and cob(ii)alamin (see paper)
36% identity, 32% coverage: 765:1128/1129 of query aligns to 179:543/708 of 8dyjB
- binding adenosine-5'-diphosphate: R192 (≠ Q778), Y228 (= Y815), H229 (= H816), F272 (= F859), Q316 (= Q901), N352 (= N937), E356 (= E941), L360 (≠ T945), P361 (= P946)
- binding cobalamin: V191 (≠ A777), R192 (≠ Q778), H229 (= H816), E232 (= E819), G319 (= G904), W320 (≠ R905), E356 (= E941), G359 (≠ T944), L360 (≠ T945)
Sites not aligning to the query:
- binding adenosine-5'-diphosphate: 74, 151
- binding cobalamin: 102, 104, 107, 124, 590, 591, 592, 593, 594, 598, 636, 638, 640, 666, 667, 668, 686, 687, 690
P22033 Methylmalonyl-CoA mutase, mitochondrial; MCM; Methylmalonyl-CoA isomerase; EC 5.4.99.2 from Homo sapiens (Human) (see 28 papers)
36% identity, 32% coverage: 765:1128/1129 of query aligns to 215:579/750 of P22033
- G215 (= G765) to C: in MMAM; mut- and mut0; dbSNP:rs121918258; to S: in MMAM; mut0; dbSNP:rs121918258
- TIQ 216:218 (≠ TVQ 766:768) binding
- Q218 (= Q768) to H: in MMAM; mut0 and mut-; no effect on protein abundance; loss of methylmalonyl-CoA mutase activity; alters thermodynamic stability; dbSNP:rs1446389693
- N219 (≠ A769) to Y: in MMAM; mut0; no effect on protein abundance; loss of methylmalonyl-CoA mutase activity; dbSNP:rs121918256
- R228 (≠ Q778) binding ; to Q: in MMAM; mut0; dbSNP:rs770810987
- T230 (= T780) to I: in MMAM; mut-; to R: in MMAM; mut0; decreased protein abundance; decreased methylmalonyl-CoA mutase activity; dbSNP:rs879253833
- Y231 (≠ C781) to N: in MMAM; mut-; no effect on protein abundance; decreased methylmalonyl-CoA mutase activity; strong decreased affinity for adenosylcob(III)alamin; alters thermodynamic stability; dbSNP:rs864309736
- K255 (≠ N806) binding
- S262 (= S813) to N: in MMAM; mut0
- H265 (= H816) binding ; to Y: in MMAM; mut-
- E276 (≠ Q827) to D: in MMAM; uncertain significance; mut-; dbSNP:rs12175488
- L281 (= L832) to S: in MMAM; mut0; dbSNP:rs796052007
- G284 (= G835) to E: in MMAM; mut0; dbSNP:rs879253835; to R: in MMAM; mut0; dbSNP:rs761477436
- S288 (≠ V839) to P: in MMAM; mut0; decreased protein abundance; decreased methylmalonyl-CoA mutase activity; dbSNP:rs1179778233
- G291 (≠ Y842) to E: in MMAM; mut0
- Q293 (≠ S844) to P: in MMAM; mut0
- RLS 304:306 (≠ NLS 855:857) binding
- L305 (= L856) to S: in MMAM; mut0; decreased protein abundance; decreased methylmalonyl-CoA mutase activity; dbSNP:rs1554160246
- S306 (= S857) to F: in MMAM; mut0; dbSNP:rs1085307929
- W309 (≠ F860) to G: in MMAM; decreased protein expression
- G312 (= G863) to V: in MMAM; mut0; dbSNP:rs864309734
- Y316 (= Y868) to C: in MMAM; mut-; no effect on protein abundance; decreased methylmalonyl-CoA mutase activity; no decreased affinity for adenosylcob(III)alamin; dbSNP:rs781474200
- A324 (≠ V874) to T: in MMAM; mut-; dbSNP:rs780387525
- R326 (= R876) to K: in MMAM; uncertain significance; dbSNP:rs758577372
- L328 (≠ I878) to F: in MMAM; mut0; affects proper folding; no effect on protein abundance; loss of methylmalonyl-CoA mutase activity; dbSNP:rs796052002; to P: in MMAM; mut0; dbSNP:rs965316043
- S344 (= S893) to F: in MMAM; mut-; affects proper folding; no effect on protein abundance; loss of methylmalonyl-CoA mutase activity; decreased affinity for adenosylcob(III)alamin
- L346 (≠ K895) natural variant: Missing (in MMAM; mut0)
- L347 (= L896) to R: in MMAM; mut0; dbSNP:rs1026703654
- H350 (= H899) to Y: in MMAM; mut0; dbSNP:rs1407914109
- L358 (= L907) to P: in MMAM; mut0
- N366 (= N915) to S: in MMAM; mut-; no effect on protein abundance; loss of methylmalonyl-CoA mutase activity; decreased affinity for adenosylcob(III)alamin; alters thermodynamic stability; dbSNP:rs864309737
- R369 (= R918) to C: in MMAM; mut0; dbSNP:rs772552898; to H: in MMAM; mut- and mut0; no effect on protein abundance; loss of methylmalonyl-CoA mutase activity; alters thermodynamic stability; dbSNP:rs564069299
- T370 (= T919) to P: in MMAM; mut0; dbSNP:rs368790885
- A377 (= A926) to E: in MMAM; mut0; decreased protein abundance; decreased methylmalonyl-CoA mutase activity; dbSNP:rs121918250
- Q383 (≠ N932) to H: in MMAM; mut0; to P: in MMAM; mut0
- H386 (= H935) to N: in MMAM; mut0; dbSNP:rs1554159937; to R: in MMAM; mut0; dbSNP:rs866933356
- T387 (= T936) to I: in MMAM; mut-; no effect on protein abundance; decreased methylmalonyl-CoA mutase activity; decreased affinity for adenosylcob(III)alamin; alters thermodynamic stability
- N388 (= N937) to H: in MMAM; mut0; dbSNP:rs766010704; to K: in MMAM; mut0; decreased protein abundance; decreased methylmalonyl-CoA mutase activity; dbSNP:rs879253840
- S389 (≠ A938) natural variant: Missing (in MMAM; mut0)
- I412 (= I961) natural variant: Missing (in MMAM; mut0)
- P424 (= P973) to L: in MMAM; mut0; decreased protein abundance; decreased methylmalonyl-CoA mutase activity; dbSNP:rs879253842
- G426 (≠ Q975) to E: in MMAM; mut-; decreased protein abundance; decreased methylmalonyl-CoA mutase activity; dbSNP:rs533755473; to R: in MMAM; mut-; no effect on protein abundance; decreased methylmalonyl-CoA mutase activity; strong decreased affinity for adenosylcob(III)alamin; alters thermodynamic stability; dbSNP:rs769922244
- G427 (= G976) to D: in MMAM; mut0; dbSNP:rs753288303
- G454 (= G1003) to E: in MMAM; mut0
- A499 (≠ S1047) to T: in dbSNP:rs2229385
- I505 (≠ G1053) to T: in MMAM; decreased protein expression; decreased methylmalonyl-CoA mutase activity
- Q514 (= Q1066) to E: in MMAM; uncertain significance; to K: in MMAM; decreased protein expression
- L518 (= L1070) to P: in MMAM; mut0; dbSNP:rs864309738
- R532 (≠ D1083) to H: in dbSNP:rs1141321
- A535 (≠ K1086) to P: in MMAM; mut0; dbSNP:rs760183775
- A552 (≠ L1102) to V: in MMAM; uncertain significance; dbSNP:rs879253845
- C560 (= C1109) to Y: in MMAM; mut0; dbSNP:rs1238333040
- T566 (≠ S1115) to R: in MMAM; mut0
- F573 (≠ G1122) to S: in MMAM; mut-; affects proper folding; no effect on protein abundance; no effect on methylmalonyl-CoA mutase activity; decreased affinity for adenosylcob(III)alamin; does not alter thermodynamic stability; dbSNP:rs775593146
Sites not aligning to the query:
- 1:32 modified: transit peptide, Mitochondrion
- 7:750 natural variant: Missing (in MMAM; mut-)
- 50 binding
- 69 I → V: in MMAM; likely benign; dbSNP:rs115923556
- 86 P → L: in MMAM; mut0 and mut-; no effect on protein abundance; decreased methylmalonyl-CoA mutase activity; decreased affinity for adenosylcob(III)alamin; alters thermodynamic stability; dbSNP:rs769348060
- 87 G → E: in MMAM; mut0; dbSNP:rs1554160986
- 93 R → H: in MMAM; mut0; decreased methylmalonyl-CoA mutase activity; dbSNP:rs121918251
- 94 G → R: in MMAM; mut0; dbSNP:rs727504022; G → V: in MMAM; mut- and mut0; dbSNP:rs535411418
- 95 P → R: in MMAM; mut0; dbSNP:rs190834116
- 96:99 binding
- 100 Y → C: in MMAM; mut-; no effect on protein abundance; decreased methylmalonyl-CoA mutase activity; decreased affinity for adenosylcob(III)alamin; alters thermodynamic stability; dbSNP:rs864309735
- 105 W → R: in MMAM; mut0; dbSNP:rs121918249
- 106:110 binding
- 108 R → C: in MMAM; mut0; dbSNP:rs121918257; R → G: in MMAM; mut-; R → H: in MMAM; mut0; dbSNP:rs483352778
- 109 Q → R: in MMAM; mut0; dbSNP:rs1461110052
- 133 G → R: in MMAM; mut0; decreased protein abundance; decreased methylmalonyl-CoA mutase activity; dbSNP:rs879253828
- 137 A → V: in MMAM; mut0; dbSNP:rs941483851
- 139 D → N: in MMAM; uncertain significance; dbSNP:rs879253829
- 140 L → P: in MMAM; decreased protein expression; decreased methylmalonyl-CoA mutase activity
- 141 A → T: in MMAM; decreased protein expression; dbSNP:rs1554160730
- 143 H → Y: in MMAM; mut0
- 145 G → S: in MMAM; mut0
- 148 S → L: in MMAM; mut0; dbSNP:rs1300547552
- 152:750 natural variant: Missing (in MMAM; mut0)
- 156 D → N: in MMAM; mut-
- 158 G → V: in MMAM; mut0
- 161 G → R: in MMAM; mut0; decreased protein abundance; decreased methylmalonyl-CoA mutase activity; G → V: in MMAM; decreased protein expression
- 174 F → S: in MMAM; mut0; dbSNP:rs864309733
- 186 M → V: in MMAM; mut-; dbSNP:rs148331800
- 187 T → S: in MMAM; mut0; dbSNP:rs879253830
- 189 N → I: in MMAM; mut-; decreased protein abundance; decreased methylmalonyl-CoA mutase activity; dbSNP:rs200908035; N → K: in MMAM; mut-; dbSNP:rs1561959114
- 191 A → E: in MMAM; mut- and mut0; affects proper folding; reduced protein level; decreased methylmalonyl-CoA mutase activity; dbSNP:rs760782399
- 197 A → E: in MMAM; mut0
- 203 G → R: in MMAM; mut0; decreased protein abundance; decreased methylmalonyl-CoA mutase activity; dbSNP:rs778702777
- 205 natural variant: Missing (in MMAM; mut0; dbSNP:rs879253831)
- 228:750 natural variant: Missing (in MMAM; mut0)
- 587 Y → C: in MMAM; mut-
- 597 I → R: in MMAM; no changed in protein expression; decreased methylmalonyl-CoA mutase activity; dbSNP:rs1554158951
- 615 P → L: in MMAM; mut0; affects proper folding; reduced strongly protein level; P → R: in MMAM; mut0; dbSNP:rs1554158777; P → T: in MMAM; mut0; affects proper folding; reduced strongly protein level; loss of methylmalonyl-CoA mutase activity; dbSNP:rs1302409621
- 616 R → C: in MMAM; mut0; dbSNP:rs765284825
- 617 L → R: in MMAM; mut0; dbSNP:rs1554158775
- 621 K → N: in MMAM; mut0
- 623 G → R: in MMAM; mut0; dbSNP:rs121918254
- 624 Q → R: in MMAM; no effect on protein abundance; dbSNP:rs768521956
- 625 D → G: in MMAM; mut0; decreased protein abundance; decreased methylmalonyl-CoA mutase activity; dbSNP:rs879253847; D → V: in MMAM; mut0; no effect on protein abundance; decreased methylmalonyl-CoA mutase activity
- 626 G → C: in MMAM; mut-; dbSNP:rs982110849
- 627 binding axial binding residue; H → R: in MMAM; mut0; dbSNP:rs372486357
- 630 G → E: in MMAM; mut0; dbSNP:rs143023066
- 633 V → G: in MMAM; mut-; no effect on protein abundance; decreased methylmalonyl-CoA mutase activity; decreased affinity for adenosylcob(III)alamin; does not alter thermodynamic stability; dbSNP:rs200055428
- 637 G → E: in MMAM; mut-; G → R: in MMAM; mut0; dbSNP:rs781501004
- 638 F → I: in MMAM; mut0
- 640 D → Y: in MMAM; mut0; dbSNP:rs865815395
- 642 G → R: in MMAM; mut-; dbSNP:rs747897332
- 648 G → D: in MMAM; mut-; no effect on protein abundance; decreased methylmalonyl-CoA mutase activity; strong decreased affinity for adenosylcob(III)alamin; alters thermodynamic stability; dbSNP:rs766721811
- 669 V → E: in MMAM; mut0; dbSNP:rs1360470463
- 671 I → V: in dbSNP:rs8589
- 674 L → F: in MMAM; decreased protein abundance; decreased methylmalonyl-CoA mutase activity; dbSNP:rs1164271240
- 678 H → R: in MMAM; mut-; dbSNP:rs147094927
- 684 natural variant: E -> EL (in MMAM; mut-)
- 685 L → R: in MMAM; mut-; dbSNP:rs864309739
- 694 R → L: in MMAM; mut-; decreased protein abundance; loss of methylmalonyl-CoA mutase activity; decreased affinity for adenosylcob(III)alamin; alters thermodynamic stability; R → W: in MMAM; mut- and mut0; no effect on protein abundance; loss of methylmalonyl-CoA mutase activity; decreased affinity for adenosylcob(III)alamin; alters thermodynamic stability; dbSNP:rs777758903
- 700 M → K: in MMAM; mut-; no effect on protein abundance; loss of methylmalonyl-CoA mutase activity; decreased affinity for adenosylcob(III)alamin; alters thermodynamic stability; dbSNP:rs140600746
- 703 G → R: in MMAM; mut0; dbSNP:rs121918255
- 717 G → V: in MMAM; mut-; no effect on protein abundance; interferes with the binding of the cofactor to the apoenzyme; decreased methylmalonyl-CoA mutase activity; strong decreased affinity for adenosylcob(III)alamin; decreased thermodynamic stability; dbSNP:rs121918252
- 723 G → D: in MMAM; decreased protein expression; decreased methylmalonyl-CoA mutase activity; dbSNP:rs755077681
2xiqA Crystal structure of human methylmalonyl-coa mutase in complex with adenosylcobalamin and malonyl-coa (see paper)
36% identity, 32% coverage: 765:1128/1129 of query aligns to 180:544/714 of 2xiqA
- active site: Y229 (= Y815), H230 (= H816)
- binding cobalamin: R193 (≠ Q778), E233 (= E819), G320 (= G904), W321 (≠ R905), E357 (= E941), G360 (≠ T944), L361 (≠ T945)
- binding malonyl-coenzyme a: T181 (= T766), R193 (≠ Q778), K220 (≠ N806), H230 (= H816), R269 (≠ N855), S271 (= S857), F273 (= F859), R313 (≠ K897), A314 (≠ Y898), H315 (= H899), Q317 (= Q901), Q348 (≠ N932)
Sites not aligning to the query:
- active site: 75, 586, 590, 592
- binding cobalamin: 75, 105, 108, 125, 591, 592, 593, 594, 595, 599, 635, 637, 639, 641, 667, 668, 687, 688, 691
- binding malonyl-coenzyme a: 61, 63, 64, 68, 71, 73, 75, 150, 152
I3VE77 2-hydroxyisobutanoyl-CoA mutase large subunit; 2-hydroxyisobutyryl-CoA mutase large subunit; HCM large subunit; EC 5.4.99.64 from Aquincola tertiaricarbonis (see 2 papers)
35% identity, 33% coverage: 760:1126/1129 of query aligns to 190:557/562 of I3VE77
Sites not aligning to the query:
- 76:79 binding
- 86:88 binding
- 90 I→A: 6-fold decrease in catalytic efficiency with 2-hydroxyisobutyryl-CoA as substrate. 320-fold decrease in catalytic efficiency with (S)-3-hydroxybuytryl-CoA as substrate. 6-fold increase in catalytic efficiency with (R)-3-hydroxybutyryl-CoA as substrate. No change in catalytic efficiencies with pivalyl-CoA and isovaleryl-CoA as substrates.; mutation I->F,Y: Loss of activity.; I→L: 37-fold decrease in catalytic efficiency with 2-hydroxyisobutyryl-CoA as substrate. 290-fold decrease in catalytic efficiency with (S)-3-hydroxybuytryl-CoA as substrate. Does not show any significant activities with pivalyl-CoA and isovaleryl-CoA.; I→V: 100-fold decrease in catalytic efficiency with (S)-3-hydroxybuytryl-CoA as substrate. No change in catalytic efficiencies with pivalyl-CoA and isovaleryl-CoA as substrates.
- 117 binding ; D→A: 2-fold increase in catalytic efficiency with 2-hydroxyisobutyryl-CoA as substrate. Small increase in catalytic efficiency with (S)-3-hydroxybuytryl-CoA as substrate. 1800-fold increase in catalytic efficiency with (R)-3-hydroxybutyryl-CoA as substrate.; D→V: 1.5-fold increase in catalytic efficiency with 2-hydroxyisobutyryl-CoA as substrate. 3-fold decrease in catalytic efficiency with (S)-3-hydroxybuytryl-CoA as substrate. 1300-fold increase in catalytic efficiency with (R)-3-hydroxybutyryl-CoA as substrate. 74-fold increase in catalytic efficiency with pivalyl-CoA as substrate.
4r3uA Crystal structure of 2-hydroxyisobutyryl-coa mutase (see paper)
35% identity, 33% coverage: 760:1126/1129 of query aligns to 189:556/557 of 4r3uA
- active site: Y243 (= Y815), H244 (= H816)
- binding 3-hydroxybutanoyl-coenzyme a: T195 (= T766), Q197 (= Q768), R234 (≠ N806), N236 (≠ Y808), N239 (≠ S811), Y243 (= Y815), H244 (= H816), R283 (≠ N855), F287 (= F859), R327 (≠ K897), F328 (≠ Y898), H329 (= H899), Q331 (= Q901), Q362 (≠ N932)
- binding S-{(3R,5R,9R)-1-[(2R,3S,4R,5R)-5-(6-amino-9H-purin-9-yl)-4-hydroxy-3-(phosphonooxy)tetrahydrofuran-2-yl]-3,5,9-trihydroxy-8,8-dimethyl-3,5-dioxido-10,14-dioxo-2,4,6-trioxa-11,15-diaza-3lambda~5~,5lambda~5~-diphosphaheptadecan-17-yl} 2-hydroxy-2-methylpropanethioate: T195 (= T766), Q197 (= Q768), R234 (≠ N806), N236 (≠ Y808), N239 (≠ S811), H244 (= H816), R283 (≠ N855), F287 (= F859), R327 (≠ K897), F328 (≠ Y898), H329 (= H899), Q331 (= Q901), Q362 (≠ N932)
- binding cobalamin: Q207 (= Q778), E209 (≠ T780), E247 (= E819), A334 (≠ G904), E371 (= E941), A372 (= A942), A374 (≠ T944)
Sites not aligning to the query:
- active site: 89
- binding 3-hydroxybutanoyl-coenzyme a: 75, 77, 78, 82, 85, 87, 89, 116, 164, 166
- binding S-{(3R,5R,9R)-1-[(2R,3S,4R,5R)-5-(6-amino-9H-purin-9-yl)-4-hydroxy-3-(phosphonooxy)tetrahydrofuran-2-yl]-3,5,9-trihydroxy-8,8-dimethyl-3,5-dioxido-10,14-dioxo-2,4,6-trioxa-11,15-diaza-3lambda~5~,5lambda~5~-diphosphaheptadecan-17-yl} 2-hydroxy-2-methylpropanethioate: 75, 77, 78, 82, 85, 87, 89, 116, 164, 166
- binding cobalamin: 116, 119, 139
8gjuJ Crystal structure of human methylmalonyl-coa mutase (mmut) in complex with methylmalonic acidemia type a protein (mmaa), coenzyme a, and gdp (see paper)
36% identity, 32% coverage: 765:1126/1129 of query aligns to 180:542/689 of 8gjuJ
Sites not aligning to the query:
P11653 Methylmalonyl-CoA mutase large subunit; MCM-alpha; EC 5.4.99.2 from Propionibacterium freudenreichii subsp. shermanii (see 4 papers)
32% identity, 32% coverage: 765:1125/1129 of query aligns to 194:559/728 of P11653
- T195 (= T766) binding
- Q197 (= Q768) binding
- V206 (≠ A777) binding
- R207 (≠ Q778) binding ; binding
- H244 (= H816) binding
- R283 (≠ N855) binding
- S285 (= S857) binding
- G333 (= G904) binding
- E370 (= E941) binding
- A373 (≠ T944) binding
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 75 binding
- 78 binding
- 82 binding
- 85 binding
- 87 binding
- 89 binding ; Y→F: Does not significantly affect affinity for succiny-CoA, but kcat is lowered about 580-fold.
- 114 binding
- 117 binding
- 139 binding
- 609 binding
- 610 binding axial binding residue
- 611 binding
- 612 binding
- 655 binding
- 657 binding
- 686 binding
- 709 binding
5reqA Methylmalonyl-coa mutase, y89f mutant, substrate complex (see paper)
32% identity, 32% coverage: 765:1125/1129 of query aligns to 191:556/725 of 5reqA
- active site: Y240 (= Y815), H241 (= H816)
- binding cobalamin: R204 (≠ Q778), H241 (= H816), E244 (= E819), G330 (= G904), W331 (≠ R905), E367 (= E941), A368 (= A942), A370 (≠ T944)
- binding methylmalonyl(carbadethia)-coenzyme a: T192 (= T766), Q194 (= Q768), R204 (≠ Q778), N233 (≠ Y808), H241 (= H816), R280 (≠ N855), S282 (= S857), F284 (= F859), T324 (≠ Y898), H325 (= H899), Q358 (≠ N932), S359 (= S933)
- binding succinyl(carbadethia)-coenzyme a: T192 (= T766), R204 (≠ Q778), N233 (≠ Y808), H241 (= H816), R280 (≠ N855), S282 (= S857), F284 (= F859), H325 (= H899), Q358 (≠ N932)
Sites not aligning to the query:
- active site: 86, 601, 605, 607
- binding cobalamin: 116, 136, 606, 607, 608, 609, 610, 614, 652, 654, 682, 683, 684, 702, 703, 706
- binding methylmalonyl(carbadethia)-coenzyme a: 72, 74, 75, 79, 82, 84, 86, 111, 161, 163
- binding succinyl(carbadethia)-coenzyme a: 72, 74, 75, 79, 82, 84, 86, 161, 163
7reqA Methylmalonyl-coa mutase, 2-carboxypropyl-coa inhibitor complex (see paper)
32% identity, 32% coverage: 765:1125/1129 of query aligns to 191:556/725 of 7reqA
- active site: Y240 (= Y815), H241 (= H816)
- binding 2-carboxypropyl-coenzyme a: T192 (= T766), R204 (≠ Q778), H241 (= H816), R280 (≠ N855), S282 (= S857), F284 (= F859), H325 (= H899), Q358 (≠ N932)
- binding cobalamin: R204 (≠ Q778), E244 (= E819), G330 (= G904), W331 (≠ R905), E367 (= E941), A368 (= A942), A370 (≠ T944)
Sites not aligning to the query:
- active site: 86, 601, 605, 607
- binding 2-carboxypropyl-coenzyme a: 72, 74, 75, 78, 79, 82, 84, 86, 161, 163
- binding cobalamin: 86, 116, 136, 606, 607, 608, 609, 610, 614, 652, 654, 682, 683, 702, 703, 706
3reqA Methylmalonyl-coa mutase, substrate-free state (poor quality structure) (see paper)
32% identity, 32% coverage: 765:1125/1129 of query aligns to 191:556/725 of 3reqA
Sites not aligning to the query:
- active site: 86, 601, 605, 607
- binding adenosine: 86
- binding cobalamin: 116, 606, 607, 608, 609, 610, 614, 650, 652, 654, 682, 683, 702, 703, 704, 706
2reqA Methylmalonyl-coa mutase, non-productive coa complex, in open conformation representing substrate-free state (see paper)
32% identity, 32% coverage: 765:1125/1129 of query aligns to 191:556/725 of 2reqA
Sites not aligning to the query:
- active site: 86, 601, 605, 607
- binding cobalamin: 606, 607, 608, 609, 610, 614, 650, 652, 654, 655, 682, 683, 702, 703, 706
- binding coenzyme a: 72, 79
4reqA Methylmalonyl-coa mutase substrate complex (see paper)
32% identity, 32% coverage: 765:1125/1129 of query aligns to 192:557/726 of 4reqA
- active site: Y241 (= Y815), H242 (= H816)
- binding cobalamin: V204 (≠ A777), R205 (≠ Q778), H242 (= H816), E245 (= E819), G331 (= G904), W332 (≠ R905), E368 (= E941), A369 (= A942), A371 (≠ T944), L372 (≠ T945)
- binding methylmalonyl-coenzyme a: T193 (= T766), R205 (≠ Q778), N234 (≠ Y808), Y241 (= Y815), H242 (= H816), R281 (≠ N855), S283 (= S857), F285 (= F859), H326 (= H899), Q328 (= Q901), Q359 (≠ N932), S360 (= S933)
- binding succinyl-coenzyme a: T193 (= T766), Q195 (= Q768), R205 (≠ Q778), N234 (≠ Y808), Y241 (= Y815), H242 (= H816), R281 (≠ N855), S283 (= S857), F285 (= F859), R324 (≠ K897), H326 (= H899), Q359 (≠ N932)
Sites not aligning to the query:
- active site: 87, 602, 606, 608
- binding cobalamin: 87, 117, 137, 607, 608, 609, 610, 611, 615, 653, 655, 683, 684, 685, 703, 704, 707
- binding methylmalonyl-coenzyme a: 73, 76, 79, 80, 83, 85, 87, 112, 162, 164
- binding succinyl-coenzyme a: 73, 76, 79, 80, 83, 85, 87, 162, 164
Query Sequence
>CA265_RS14780 FitnessBrowser__Pedo557:CA265_RS14780
MQQVEIYKPKNKIRFVTAASLFDGHDATINIMRRILQSSGAEVIHLGHNRSVDEVVNCAI
QEDVQGIAMTSYQGGHIEYFKYMYDLLQERGSGHIKIFAGGGGVILPSEIEELQAYGISK
IYSPDDGRKMGLQGMINDMLVQTDFITKASITNELETIPSKDIKAIAGAITVAENDPEGA
QKFVDELKKLSKNNTAPILGITGTGGAGKSSLVDELVRRFLVEVKDKTLAIISVDPSKRK
TGGALLGDRIRMNAINNPRVYMRSLATRQANLALSKNVQESIDICKAAGYDLIIVETSGI
GQSDTEITEHCDVSLYVMTPEFGAATQLEKIDMLDFADLVAINKFDKRGALDALRDVRKQ
YKRNHNIFDAKDDEIPVYGTMASQFNDPGMNNLFVALMEQIKVKTGTDFKAKMELTSDQS
EKIYIIPPDRIRYLAEIAEASQMYNEWVDKQATIARKMYQLKGVIDLLSEANLPDKSKVS
PTGGDLEGVYAFFEEQLDGECKRLLRQWPDTKRAYKEEFFIYKVRDKEIKQPLFYESLSK
LNIPKVSLPRYEDWGDILRWLLTENLPGEFPYAAGVFPLKREGEDPTRMFAGEGGPERTN
KRFHYVSLGQPAHRLSTAFDSVTLYGEDPHIRPDIYGKIGNSGVCIATLDDAKKLYSGFD
LCAPSTSVSMTINGPAPMLLGFFMNAAIDQQCEKYIIENDLTKEVEAKIDAIYQAKNIPR
PSYNGTLPEGNDGLGLMLLGVTGDQVLPADIYAKIRTKAISSVRGTVQADILKEDQAQNT
CIFSTEFALRMMGDIQKYFIDEKVRNFYSVSISGYHIAEAGANPISQLAFTLSNGFTFVE
YYLSRGMHIDDFAPNLSFFFSNGIDPEYAVIGRVARRIWAKAIKNKYKGNDRSQKLKYHI
QTSGRSLHAQEIDFNDIRTTLQALYAIYDNCNSLHTNAYDEAITTPTEESVRRAMAIQLI
INRELGLAKNENPLQGAFIIEELTDLVEDAVLAEFKRINDRGGVLGAMETMYQRGKIQEE
SLYYETLKHTGEYPIVGVNTFLNKNGSPTIVPGEVIRATEDEKQYQISALQKFQDRNADR
AVDLLKQLQKSAIAGDNIFEQLMEVCKICSLGQISKALYEVGGQYRRNM
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory