Comparing CA265_RS19300 FitnessBrowser__Pedo557:CA265_RS19300 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 7 hits to proteins with known functional sites (download)
8w78A Structure of drosophila melanogaster l-2-hydroxyglutarate dehydrogenase in complex with fad and 2-oxoglutarate (see paper)
45% identity, 99% coverage: 6:399/399 of query aligns to 3:405/410 of 8w78A
8w7fB Structure of drosophila melanogaster l-2-hydroxyglutarate dehydrogenase bound with fad and a sulfate ion (see paper)
45% identity, 99% coverage: 6:399/399 of query aligns to 3:407/412 of 8w7fB
3dmeA Crystal structure of conserved exported protein from bordetella pertussis. Northeast structural genomics target ber141
32% identity, 67% coverage: 7:273/399 of query aligns to 4:271/366 of 3dmeA
Sites not aligning to the query:
4x9mA Oxidized l-alpha-glycerophosphate oxidase from mycoplasma pneumoniae with fad bound (see paper)
28% identity, 70% coverage: 7:285/399 of query aligns to 5:287/384 of 4x9mA
Sites not aligning to the query:
P75063 Glycerol 3-phosphate oxidase; GlpO; L-alpha-glycerophosphate oxidase; EC 1.1.3.21 from Mycoplasma pneumoniae (strain ATCC 29342 / M129 / Subtype 1) (Mycoplasmoides pneumoniae) (see paper)
28% identity, 70% coverage: 7:285/399 of query aligns to 5:287/384 of P75063
Sites not aligning to the query:
1zovA Crystal structure of monomeric sarcosine oxidase from bacillus sp. Ns- 129
23% identity, 56% coverage: 6:227/399 of query aligns to 4:222/381 of 1zovA
Sites not aligning to the query:
7cyxA Crystal strcuture of glycine oxidase from bacillus cereus atcc 14579 (see paper)
23% identity, 61% coverage: 5:246/399 of query aligns to 1:239/363 of 7cyxA
Sites not aligning to the query:
>CA265_RS19300 FitnessBrowser__Pedo557:CA265_RS19300
MSIKKYDIIVVGAGLVGLSTAYQLKIAQPELNVLILDKEDGVAKHQSGHNSGVIHSGIYY
KPGSLKAQNCISGYQSIIEFAQQHEIPYDICGKIIVATDQKELPGLNNIYQRGIENGLKG
LKRLSAAESREIEPHCAALESIFVPQTGIIDYPKMAEKILELFMALGGEISFNQEVNKIQ
QDSKCIIVKTNLEVYSTVKLVSCGGLFSDRIASLTEDDNNLRIIPFRGEYYKLKTERESL
VKHLIYPVPDPEFPFLGVHFTRMIGGGIEAGPNAVLAFKREGYKFSDFSLKDMGDTLAWP
GFWKIVAKYGQTGMGEIYRSLSKAAFTRSLQKLIPEINQSDLVEGGAGVRAQACDKKGNL
IDDFNILQNANIIHVRNAPSPAATSSLSIGKLISDKILN
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory