Comparing CA265_RS19865 FitnessBrowser__Pedo557:CA265_RS19865 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 10 hits to proteins with known functional sites (download)
2afbA Crystal structure of 2-dehydro-3- deoxygluconokinase (ec 2.7.1.45) (tm0067) from thermotoga maritima at 2.05 a resolution (see paper)
30% identity, 95% coverage: 14:345/351 of query aligns to 7:325/329 of 2afbA
Sites not aligning to the query:
Q53W83 2-dehydro-3-deoxygluconokinase; 2-keto-3-deoxygluconokinase; 3-deoxy-2-oxo-D-gluconate kinase; KDG kinase; EC 2.7.1.45 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see paper)
27% identity, 88% coverage: 14:321/351 of query aligns to 3:274/309 of Q53W83
Sites not aligning to the query:
1v1bA 2-keto-3-deoxygluconate kinase from thermus thermophilus with bound atp (see paper)
27% identity, 88% coverage: 14:322/351 of query aligns to 3:275/300 of 1v1bA
Sites not aligning to the query:
1v1aA 2-keto-3-deoxygluconate kinase from thermus thermophilus with bound 2- keto-3-deoxygluconate and adp (see paper)
27% identity, 88% coverage: 14:322/351 of query aligns to 3:275/301 of 1v1aA
Sites not aligning to the query:
3ktnA Crystal structure of a putative 2-keto-3-deoxygluconate kinase from enterococcus faecalis
25% identity, 94% coverage: 14:343/351 of query aligns to 3:324/340 of 3ktnA
2varA Crystal structure of sulfolobus solfataricus 2-keto-3-deoxygluconate kinase complexed with 2-keto-3-deoxygluconate (see paper)
26% identity, 48% coverage: 15:184/351 of query aligns to 3:169/311 of 2varA
Sites not aligning to the query:
Q97U29 2-dehydro-3-deoxygluconokinase/2-dehydro-3-deoxygalactonokinase; 2-dehydro-3-deoxyglucono/galactono-kinase; 2-keto-3-deoxy-galactonokinase; 2-keto-3-deoxygluconokinase; 3-deoxy-2-oxo-D-gluconate kinase; KDG kinase; KDGal kinase; EC 2.7.1.178 from Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) (Sulfolobus solfataricus) (see paper)
26% identity, 48% coverage: 15:184/351 of query aligns to 4:170/313 of Q97U29
Sites not aligning to the query:
3ih0A Crystal structure of an uncharacterized sugar kinase ph1459 from pyrococcus horikoshii in complex with amp-pnp
24% identity, 84% coverage: 15:308/351 of query aligns to 3:256/304 of 3ih0A
Sites not aligning to the query:
3gbuA Crystal structure of an uncharacterized sugar kinase ph1459 from pyrococcus horikoshii in complex with atp
24% identity, 84% coverage: 15:308/351 of query aligns to 2:255/302 of 3gbuA
Sites not aligning to the query:
2dcnA Crystal structure of 2-keto-3-deoxygluconate kinase from sulfolobus tokodaii complexed with 2-keto-6-phosphogluconate (alpha-furanose form)
22% identity, 53% coverage: 14:200/351 of query aligns to 2:185/308 of 2dcnA
Sites not aligning to the query:
>CA265_RS19865 FitnessBrowser__Pedo557:CA265_RS19865
MSTQIFASSKKGEKVLSFGEILLRICPDMDGQWLKENKLPFYVGGAELNVATALALWNVP
STYLSAVPDNSVTREIVDYLDARNIDTTPMVYHGERLGLYYLPKGKDLKNAGVIYDRANS
AYADLKVGQINWDEVFEGVSWFHFSAICPAINQSIADVCLEALKVASAKNITISLDLNYR
AKLWKYGKDPIDVLPQLAQYCTLIMGNVWAANKMLGTALHEDLIPTEGYAKETLLQQATD
TSKEILSLFPACKAVANTFRFDHGKGIRYYTAIYTADELTVSEEYVSEEILDKVGSGDCF
MAGLIYGFYNQLSAKETLNFATAAAYDKLYIPSDATTSTVADIEKRIIRND
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory