SitesBLAST
Comparing CCNA_00233 FitnessBrowser__Caulo:CCNA_00233 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
O25511 UDP-N-acetylglucosamine 4,6-dehydratase (inverting); Pseudaminic acid biosynthesis protein B; UDP-GlcNAc-inverting 4,6-dehydratase; EC 4.2.1.115 from Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori) (see paper)
59% identity, 96% coverage: 11:340/345 of query aligns to 8:333/333 of O25511
2gn8A Crystal structure of udp-glcnac inverting 4,6-dehydratase in complex with NADP and udp (see paper)
59% identity, 96% coverage: 11:340/345 of query aligns to 2:327/327 of 2gn8A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G11 (= G20), T13 (= T22), G14 (= G23), S15 (= S24), F16 (= F25), S37 (= S46), R38 (= R47), D39 (= D48), K42 (= K51), D61 (= D77), V62 (= V78), A81 (= A97), A82 (= A98), A83 (= A99), K85 (= K101), T100 (= T116), L123 (= L139), S124 (= S140), K139 (= K155), Y165 (= Y181), G166 (= G182), V168 (= V184), S171 (= S187), R172 (= R188)
- binding uridine-5'-diphosphate: K127 (= K143), N167 (= N183), V175 (= V191), P191 (= P207), I192 (≠ V208), T193 (= T209), M197 (= M213), R199 (= R215), M233 (= M249), R252 (= R268)
2gnaA Crystal structure of udp-glcnac inverting 4,6-dehydratase in complex with NADP and udp-gal (see paper)
59% identity, 96% coverage: 11:340/345 of query aligns to 4:329/329 of 2gnaA
- binding galactose-uridine-5'-diphosphate: K87 (= K101), S176 (= S190), V177 (= V191), T195 (= T209), M199 (= M213), R201 (= R215), M235 (= M249), R254 (= R268), E257 (= E271)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G20), T15 (= T22), G16 (= G23), S17 (= S24), F18 (= F25), S39 (= S46), R40 (= R47), D41 (= D48), K44 (= K51), D63 (= D77), V64 (= V78), A83 (= A97), A84 (= A98), A85 (= A99), K87 (= K101), L125 (= L139), S126 (= S140), Y137 (= Y151), K141 (= K155), Y167 (= Y181), G168 (= G182), V170 (= V184)
2gn9A Crystal structure of udp-glcnac inverting 4,6-dehydratase in complex with NADP and udp-glc (see paper)
59% identity, 96% coverage: 11:340/345 of query aligns to 4:329/329 of 2gn9A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G20), T15 (= T22), G16 (= G23), S17 (= S24), F18 (= F25), R40 (= R47), D41 (= D48), K44 (= K51), D63 (= D77), V64 (= V78), A83 (= A97), A84 (= A98), A85 (= A99), K87 (= K101), L125 (= L139), S126 (= S140), K141 (= K155), Y167 (= Y181), G168 (= G182), V170 (= V184), R174 (= R188)
- binding uridine-5'-diphosphate-glucose: K87 (= K101), T127 (= T141), K129 (= K143), Y137 (= Y151), N169 (= N183), S176 (= S190), V177 (= V191), P193 (= P207), T195 (= T209), M199 (= M213), R201 (= R215), M235 (= M249), R254 (= R268), E257 (= E271)
2gn6A Crystal structure of udp-glcnac inverting 4,6-dehydratase in complex with NADP and udp-glcnac (see paper)
59% identity, 96% coverage: 11:340/345 of query aligns to 4:329/329 of 2gn6A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G20), T15 (= T22), G16 (= G23), S17 (= S24), F18 (= F25), R40 (= R47), D41 (= D48), K44 (= K51), D63 (= D77), V64 (= V78), A84 (= A98), A85 (= A99), K87 (= K101), S126 (= S140), Y137 (= Y151), K141 (= K155), Y167 (= Y181), G168 (= G182), V170 (= V184), S173 (= S187), R174 (= R188)
- binding uridine-diphosphate-n-acetylglucosamine: K87 (= K101), D128 (= D142), K129 (= K143), N169 (= N183), G175 (= G189), S176 (= S190), V177 (= V191), P193 (= P207), I194 (≠ V208), M199 (= M213), R201 (= R215), M235 (= M249), R254 (= R268), E257 (= E271)
2gn4A Crystal structure of udp-glcnac inverting 4,6-dehydratase in complex with NADPH and udp-glcnac (see paper)
59% identity, 96% coverage: 11:340/345 of query aligns to 4:329/329 of 2gn4A
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G13 (= G20), T15 (= T22), G16 (= G23), S17 (= S24), F18 (= F25), S39 (= S46), R40 (= R47), D41 (= D48), K44 (= K51), D63 (= D77), V64 (= V78), A83 (= A97), A84 (= A98), A85 (= A99), K87 (= K101), T102 (= T116), L125 (= L139), S126 (= S140), T127 (= T141), Y137 (= Y151), K141 (= K155), Y167 (= Y181), G168 (= G182), V170 (= V184), S173 (= S187), R174 (= R188)
- binding uridine-diphosphate-n-acetylglucosamine: K87 (= K101), T127 (= T141), D128 (= D142), K129 (= K143), Y137 (= Y151), N169 (= N183), S176 (= S190), V177 (= V191), P193 (= P207), T195 (= T209), M199 (= M213), R201 (= R215), M235 (= M249), R254 (= R268), E257 (= E271)
3w1vA Crystal structure of capsular polysaccharide synthesizing enzyme cape from staphylococcus aureus in complex with inihibitor (see paper)
36% identity, 93% coverage: 8:328/345 of query aligns to 8:322/347 of 3w1vA
- binding [(2R,3S,4R,5R,6R)-5-acetamido-6-[[[(2R,3S,4R,5R)-5-[2,4-bis(oxidanylidene)pyrimidin-1-yl]-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl]oxy-oxidanyl-phosphoryl]oxy-3,4-bis(oxidanyl)oxan-2-yl]methylimino-azanylidene-azanium: K93 (= K101), Q94 (= Q102), N175 (= N183), S179 (= S187), R180 (= R188), S182 (= S190), V183 (= V191), L186 (= L194), T198 (≠ P207), I199 (≠ V208), T200 (= T209), M204 (= M213), R206 (= R215), V240 (≠ M249), R263 (= R268), E266 (= E271)
4j2oC Crystal structure of NADP-bound wbjb from a. Baumannii community strain d1279779 (see paper)
45% identity, 78% coverage: 14:282/345 of query aligns to 5:269/316 of 4j2oC
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G11 (= G20), T13 (= T22), G14 (= G23), S15 (= S24), F16 (= F25), S36 (= S46), R37 (= R47), D38 (= D48), K41 (= K51), D60 (= D77), V61 (= V78), A80 (= A97), A81 (= A98), A82 (= A99), K84 (= K101), T99 (= T116), L122 (= L139), K138 (= K155), Y164 (= Y181)
4g5hA Crystal structure of capsular polysaccharide synthesizing enzyme cape from staphylococcus aureus in complex with by-product (see paper)
36% identity, 93% coverage: 8:328/345 of query aligns to 8:322/346 of 4g5hA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G20 (= G20), T22 (= T22), G23 (= G23), S24 (= S24), F25 (= F25), S45 (= S46), R46 (= R47), D47 (= D48), K50 (= K51), D69 (= D77), V70 (= V78), A89 (= A97), A90 (= A98), A91 (= A99), K93 (= K101), L131 (= L139), T133 (= T141), K147 (= K155), Y173 (= Y181)
- binding [(2R,3R,4R,6R)-3-acetamido-6-methyl-4-oxidanyl-5-oxidanylidene-oxan-2-yl] [[(2R,3S,4R,5R)-5-[2,4-bis(oxidanylidene)pyrimidin-1-yl]-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl] hydrogen phosphate: Q94 (= Q102), V95 (= V103), K135 (= K143), N175 (= N183), S182 (= S190), V183 (= V191), L186 (= L194), T198 (≠ P207), T200 (= T209), M204 (= M213), V240 (≠ M249), R263 (= R268), E266 (= E271), Y278 (≠ A283), S313 (≠ D319), Y314 (≠ F320), E315 (≠ S321), Y316 (= Y322), N320 (= N326)
3vvcA Crystal structure of capsular polysaccharide synthesizing enzyme cape , k126e, in apo form (see paper)
37% identity, 93% coverage: 9:328/345 of query aligns to 1:294/318 of 3vvcA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G20), T14 (= T22), G15 (= G23), F17 (= F25), S37 (= S46), R38 (= R47), D39 (= D48), K42 (= K51), D61 (= D77), V62 (= V78), R63 (= R79), A81 (= A97), A82 (= A98), A83 (= A99), K85 (= K101), S124 (= S140), T125 (= T141), K139 (= K155), Y165 (= Y181), G166 (= G182)
6bwcC X-ray structure of pen from bacillus thuringiensis (see paper)
34% identity, 89% coverage: 14:319/345 of query aligns to 6:314/327 of 6bwcC
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G20), T14 (= T22), G15 (= G23), T16 (≠ S24), I17 (≠ F25), S37 (= S46), R38 (= R47), S39 (≠ D48), D63 (= D77), I64 (≠ V78), V83 (≠ A97), A84 (= A98), K87 (= K101), T125 (≠ L139), S127 (≠ T141), Y137 (= Y151), K141 (= K155), F167 (≠ Y181), V170 (= V184), S173 (= S187), R174 (= R188)
- binding uridine-diphosphate-n-acetylglucosamine: K87 (= K101), H88 (≠ Q102), S127 (≠ T141), N128 (≠ D142), Y137 (= Y151), N169 (= N183), S176 (= S190), V177 (= V191), L180 (= L194), T192 (≠ P207), T194 (= T209), M198 (= M213), R200 (= R215), L234 (≠ M249), E265 (= E271)
3vvbA Crystal structure of capsular polysaccharide synthesizing enzyme cape from staphylococcus aureus in apo form (see paper)
32% identity, 92% coverage: 11:328/345 of query aligns to 1:249/270 of 3vvbA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G10 (= G20), T12 (= T22), G13 (= G23), S14 (= S24), F15 (= F25), S35 (= S46), R36 (= R47), D37 (= D48), K40 (= K51), D59 (= D77), V60 (= V78), A80 (= A98), A81 (= A99), K83 (= K101), L121 (= L139), T123 (= T141), K137 (= K155), Y163 (= Y181), G164 (= G182)
4tqgA Crystal structure of megavirus udp-glcnac 4,6-dehydratase, 5-epimerase mg534 (see paper)
32% identity, 84% coverage: 11:299/345 of query aligns to 3:267/297 of 4tqgA
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G12 (= G20), S14 (≠ T22), G15 (= G23), S16 (= S24), L17 (≠ F25), R36 (= R47), D37 (= D48), D59 (= D77), I60 (≠ V78), A81 (= A97), A82 (= A98), A83 (= A99), K85 (= K101), V128 (≠ L139), Y140 (= Y151), K144 (= K155), Y168 (= Y181), G169 (= G182), V171 (= V184)
5bjuA X-ray structure of the pglf dehydratase from campylobacter jejuni in complex with udp and NAD(h) (see paper)
29% identity, 82% coverage: 6:288/345 of query aligns to 10:297/340 of 5bjuA
- binding nicotinamide-adenine-dinucleotide: G31 (= G20), G34 (= G23), T35 (≠ S24), I36 (≠ F25), D56 (≠ S46), H57 (≠ R47), S82 (≠ D77), I83 (≠ V78), A104 (= A97), A105 (= A98), A106 (= A99), K108 (= K101), N123 (≠ T116), I146 (≠ L139), K162 (= K155), F184 (≠ Y181), G185 (= G182), N186 (= N183), V187 (= V184), S190 (= S187), S191 (≠ R188)
- binding uridine-5'-diphosphate: K150 (= K143), N186 (= N183), S193 (= S190), V194 (= V191), T209 (≠ P207), L210 (≠ V208), T211 (= T209), I215 (≠ M213), R217 (= R215), E279 (= E271)
5bjvA X-ray structure of the pglf udp-n-acetylglucosamine 4,6-dehydratase from campylobacterjejuni, d396n/k397a variant in complex with udp-n- acrtylglucosamine (see paper)
29% identity, 82% coverage: 6:288/345 of query aligns to 10:297/339 of 5bjvA
- binding nicotinamide-adenine-dinucleotide: G31 (= G20), G34 (= G23), T35 (≠ S24), I36 (≠ F25), D56 (≠ S46), H57 (≠ R47), S82 (≠ D77), I83 (≠ V78), A104 (= A97), A105 (= A98), A106 (= A99), K108 (= K101), N123 (≠ T116), I146 (≠ L139), K162 (= K155), F184 (≠ Y181), G185 (= G182), N186 (= N183), V187 (= V184), S190 (= S187), S191 (≠ R188)
- binding uridine-diphosphate-n-acetylglucosamine: K108 (= K101), H109 (≠ Q102), T148 (= T141), G185 (= G182), N186 (= N183), S193 (= S190), V194 (= V191), T209 (≠ P207), L210 (≠ V208), T211 (= T209), I215 (≠ M213), R217 (= R215), R276 (= R268), E279 (= E271)
3pvzA Udp-n-acetylglucosamine 4,6-dehydratase from vibrio fischeri
26% identity, 78% coverage: 16:284/345 of query aligns to 33:290/372 of 3pvzA
- binding nicotinamide-adenine-dinucleotide: G40 (= G23), S41 (= S24), I42 (≠ F25), D62 (≠ S46), I63 (≠ R47), D92 (vs. gap), I93 (vs. gap), L114 (≠ A97), S115 (≠ A98), A116 (= A99), K118 (= K101), V158 (≠ L139), D161 (= D142), K174 (= K155), V198 (= V184), S201 (= S187)
1r66A Crystal structure of desiv (dtdp-glucose 4,6-dehydratase) from streptomyces venezuelae with NAD and tyd bound (see paper)
28% identity, 65% coverage: 16:240/345 of query aligns to 3:240/322 of 1r66A
- active site: T127 (= T141), D128 (= D142), E129 (≠ K143), Y151 (= Y151), K155 (= K155)
- binding nicotinamide-adenine-dinucleotide: G10 (= G23), F11 (≠ S24), I12 (≠ F25), D37 (= D48), S38 (≠ E49), L39 (= L50), T40 (≠ K51), G43 (≠ D54), D63 (= D77), I64 (≠ V78), F83 (≠ A97), A84 (= A98), A85 (= A99), S87 (≠ K101), T102 (= T116), V125 (≠ L139), S126 (= S140), Y151 (= Y151), K155 (= K155), N181 (≠ R180)
- binding thymidine-5'-diphosphate: H88 (≠ Q102), E129 (≠ K143), N180 (≠ V179), K190 (≠ S190), L191 (≠ V191), P206 (≠ L206), Y208 (≠ V208), R215 (= R215)
Sites not aligning to the query:
1r6dA Crystal structure of desiv double mutant (dtdp-glucose 4,6- dehydratase) from streptomyces venezuelae with NAD and dau bound (see paper)
27% identity, 65% coverage: 16:240/345 of query aligns to 3:240/322 of 1r6dA
- active site: T127 (= T141), N128 (≠ D142), Q129 (≠ K143), Y151 (= Y151), K155 (= K155)
- binding 2'deoxy-thymidine-5'-diphospho-alpha-d-glucose: S87 (≠ K101), H88 (≠ Q102), T127 (= T141), N128 (≠ D142), Q129 (≠ K143), Y151 (= Y151), N180 (≠ V179), K190 (≠ S190), L191 (≠ V191), P206 (≠ L206), Y208 (≠ V208), R215 (= R215)
- binding nicotinamide-adenine-dinucleotide: G10 (= G23), F11 (≠ S24), I12 (≠ F25), D37 (= D48), S38 (≠ E49), L39 (= L50), T40 (≠ K51), A42 (≠ S53), G43 (≠ D54), D63 (= D77), I64 (≠ V78), F83 (≠ A97), A84 (= A98), A85 (= A99), S87 (≠ K101), T102 (= T116), V125 (≠ L139), S126 (= S140), Y151 (= Y151), K155 (= K155), N181 (≠ R180)
Sites not aligning to the query:
2hunA Crystal structure of hypothetical protein ph0414 from pyrococcus horikoshii ot3
30% identity, 48% coverage: 16:182/345 of query aligns to 4:181/329 of 2hunA
- active site: T125 (= T141), D126 (= D142), E127 (≠ K143), Y149 (= Y151), K153 (= K155)
- binding nicotinamide-adenine-dinucleotide: G8 (= G20), G11 (= G23), F12 (≠ S24), I13 (≠ F25), D34 (= D48), K35 (≠ E49), S40 (≠ D54), D60 (= D77), V61 (= V78), L80 (≠ A97), A81 (= A98), A82 (= A99), S99 (≠ T116), T125 (= T141), K153 (= K155), C176 (= C177), T177 (≠ V178), N178 (≠ V179), N179 (≠ R180)
1sb9A Crystal structure of pseudomonas aeruginosa udp-n-acetylglucosamine 4- epimerase complexed with udp-glucose (see paper)
27% identity, 57% coverage: 7:202/345 of query aligns to 9:220/340 of 1sb9A
- active site: S141 (≠ T141), S142 (vs. gap), S143 (vs. gap), Y165 (= Y151), K169 (= K155), N203 (vs. gap)
- binding nicotinamide-adenine-dinucleotide: G22 (= G20), G25 (= G23), F26 (≠ S24), I27 (≠ F25), D46 (≠ Y45), N47 (≠ S46), F48 (≠ R47), T50 (≠ E49), G51 (≠ L50), D77 (= D77), I78 (≠ V78), Q97 (≠ A97), A99 (= A99), T116 (= T116), A139 (≠ L139), A140 (≠ S140), Y165 (= Y151), K169 (= K155), Y192 (= Y181), N194 (= N183), V195 (= V184)
- binding uridine-5'-diphosphate-glucose: S141 (≠ T141), Y165 (= Y151), N194 (= N183), A208 (≠ S190), V209 (= V191), W213 (≠ Y195)
Sites not aligning to the query:
Query Sequence
>CCNA_00233 FitnessBrowser__Caulo:CCNA_00233
MGRFSPKSLDLDGKVILVTGGTGSFGRRFIETVLRRYDPRKVIVYSRDELKQSDMQIELR
EQFDEATVAKMRFFLGDVRDRERLTLALRGVDIVIHAAALKQVPAAEYNPSECIHTNVLG
AENVVWASLANAVKQVVALSTDKACNPTNLYGATKLASDKTFVAANNLSGDIGTRFCVVR
YGNVVGSRGSVVPLYRRLLSQGATELPVTDPRMTRFWITLNEGVDFVLSSLTMMRGGEIF
VPKIPSMAMPDLVKAMSSTAAMKVIGIRPGEKLHEIMISADDARSTVEFDDRYAIEPNFA
EFGREPYAASDGAKPVAEDFSYSSDNNHDWLSPEGLLAMLEEKAT
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory