SitesBLAST
Comparing CCNA_01335 FitnessBrowser__Caulo:CCNA_01335 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7o12B Abc transporter nosdfy, amppnp-bound in gdn (see paper)
40% identity, 71% coverage: 4:219/305 of query aligns to 2:216/298 of 7o12B
7o17B Abc transporter nosdfy e154q, atp-bound in lipid nanodisc (see paper)
40% identity, 71% coverage: 4:219/305 of query aligns to 2:216/298 of 7o17B
- binding adenosine-5'-triphosphate: Y12 (= Y14), V17 (≠ A19), N37 (= N39), G38 (= G40), A39 (= A41), G40 (= G42), K41 (= K43), T42 (≠ S44), T43 (= T45), E80 (= E82), R123 (= R125), T127 (≠ G129), S129 (= S131), K130 (≠ V132), G131 (= G133), M132 (= M134)
- binding magnesium ion: K41 (= K43), T42 (≠ S44)
P34358 ABC transporter ced-7; Cell death protein 7 from Caenorhabditis elegans (see 2 papers)
35% identity, 71% coverage: 4:219/305 of query aligns to 1378:1592/1704 of P34358
- K1417 (= K43) mutation to R: Some cell corpses not engulfed.
Sites not aligning to the query:
- 126 modified: carbohydrate, N-linked (GlcNAc...) asparagine
- 586 K→R: Cell corpses not engulfed.
- 639 E→G: Cell corpses not engulfed.
- 1012 modified: carbohydrate, N-linked (GlcNAc...) asparagine
- 1045 modified: carbohydrate, N-linked (GlcNAc...) asparagine
5x40A Structure of a cbio dimer bound with amppcp (see paper)
35% identity, 78% coverage: 1:239/305 of query aligns to 1:250/280 of 5x40A
- binding phosphomethylphosphonic acid adenylate ester: F14 (≠ Y14), V18 (= V17), A20 (= A19), N40 (= N39), G41 (= G40), G43 (= G42), K44 (= K43), S45 (= S44), T46 (= T45), Q88 (≠ E82), H139 (≠ S128), M140 (≠ G129), L141 (≠ F130), S142 (= S131), G144 (= G133), Q145 (≠ M134), Q166 (≠ E155), H198 (= H188)
- binding magnesium ion: S45 (= S44), Q88 (≠ E82)
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
33% identity, 69% coverage: 9:217/305 of query aligns to 6:228/343 of P30750
- 40:46 (vs. 39:45, 86% identical) binding
- E166 (= E155) mutation to Q: Exhibits little ATPase activity.
Sites not aligning to the query:
- 278:283 binding
- 295 N→A: Reduces the binding of L-methionine to undetectable levels.
- 295:296 binding
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
32% identity, 69% coverage: 9:217/305 of query aligns to 7:229/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
32% identity, 69% coverage: 9:217/305 of query aligns to 7:229/344 of 3tuiC
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
32% identity, 69% coverage: 9:217/305 of query aligns to 7:229/344 of 6cvlD
- binding phosphothiophosphoric acid-adenylate ester: F12 (≠ Y14), Q14 (vs. gap), I19 (≠ V17), S41 (≠ N39), G42 (= G40), A43 (= A41), G44 (= G42), K45 (= K43), S46 (= S44), T47 (= T45), N141 (≠ G129), S143 (= S131), Q146 (≠ M134), H200 (= H188)
4yerA Crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution
34% identity, 69% coverage: 9:217/305 of query aligns to 9:223/285 of 4yerA
- binding adenosine-5'-diphosphate: F14 (≠ Y14), F17 (≠ V17), N39 (= N39), G40 (= G40), G42 (= G42), K43 (= K43), T44 (≠ S44), T45 (= T45), T135 (≠ G129), F136 (= F130), S137 (= S131)
E9Q876 Glucosylceramide transporter ABCA12; ATP-binding cassette sub-family A member 12; EC 7.6.2.1 from Mus musculus (Mouse) (see 2 papers)
33% identity, 70% coverage: 10:223/305 of query aligns to 2259:2482/2595 of E9Q876
Sites not aligning to the query:
- 1388:1461 ISMLTGLFGATAGTIFVYGKDIKTDLNTVRKNMGVCMQHDVLFSYLTTKEHLLLYGSIKVPHWTKTQLHEEVKR→M: In a mouse model for harlequin ichthyosis (HI), smooth skin (smsk) mutant mice show a pronounced perinatal lethal skin phenotype in 25% of the offspring and newborn mutant pups die within a few hours after birth, and appear severely dehydrated with dry cracking skin. Smsk homozygous mutants embryos show a normal appearance at 14.5 dpc, but at 16.5 dpc develop a partial absence of normal skin folds around the trunk and limbs, and by 18.5 dpc develop a taut, thick skin and limb contractures.
- 1996 G→D: In a mouse model for harlequin ichthyosis (HI), homozygous mice are embryonic lethal but occasionally pups are found in the first few hours after birth but die and are severely dehydrated and fail to suckle normally. Homozygous pups show hallmarks of HI desease including hyperkeratosis, abnormal extracellular lipid lamellae and defects in cornified envelope processing. At 14.5 dpc and 15.5 dpc homozygous embryos appear normal; however from 16.5 dpc onwards they are characterized by an absence of normal skin folds around the trunk and limbs. As development progressed, embryos develop a taut, thick epidermis and multiple contractures affecting the limbs. Late stage embryos are smaller.
Q9BZC7 ATP-binding cassette sub-family A member 2; ATP-binding cassette transporter 2; ATP-binding cassette 2; EC 7.6.2.- from Homo sapiens (Human) (see paper)
33% identity, 68% coverage: 10:217/305 of query aligns to 2055:2272/2435 of Q9BZC7
Sites not aligning to the query:
- 271 modified: N5-methylglutamine; Q→R: Abolishes methylation by N6AMT1.
P41233 Phospholipid-transporting ATPase ABCA1; ATP-binding cassette sub-family A member 1; ATP-binding cassette transporter 1; ABC-1; ATP-binding cassette 1; EC 7.6.2.1 from Mus musculus (Mouse) (see paper)
34% identity, 70% coverage: 5:217/305 of query aligns to 1912:2131/2261 of P41233
Sites not aligning to the query:
- 489 modified: carbohydrate, N-linked (GlcNAc...) asparagine
8ee6A Cryo-em structure of human abca7 in pe/ch nanodiscs (see paper)
35% identity, 69% coverage: 9:217/305 of query aligns to 1502:1717/1808 of 8ee6A
Sites not aligning to the query:
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
31% identity, 72% coverage: 12:232/305 of query aligns to 9:240/240 of 4ymuJ
- binding adenosine-5'-triphosphate: F11 (≠ Y14), V16 (≠ A19), S36 (≠ N39), G37 (= G40), S38 (≠ A41), G39 (= G42), K40 (= K43), S41 (= S44), T42 (= T45), E162 (= E155), H194 (= H188)
- binding magnesium ion: S41 (= S44), E162 (= E155)
O95477 Phospholipid-transporting ATPase ABCA1; ATP-binding cassette sub-family A member 1; ATP-binding cassette transporter 1; ABC-1; ATP-binding cassette 1; Cholesterol efflux regulatory protein; EC 7.6.2.1 from Homo sapiens (Human) (see 35 papers)
33% identity, 70% coverage: 5:217/305 of query aligns to 1912:2131/2261 of O95477
- R1925 (= R18) to Q: in Scott syndrome; shows impaired trafficking of the mutant protein to the plasma membrane; dbSNP:rs142688906
- K1952 (= K43) mutation to M: Inhibits ATPase activity; when associated with M-939. Decreases translocase activity; when associated with M-939. Does not affect protein subcellular localization in plasma membrane and endosome; when associated with M-939.
- S2054 (≠ G139) modified: Phosphoserine; by PKA
- R2081 (≠ Q166) to W: in TGD; highly decreased protein abundance; highly decreased ATPase activity; highly decreased phospholipid translocase activity; loss protein subcellular localization to the plasma membrane; dbSNP:rs137854501
- A2109 (≠ R195) to T: in a colorectal cancer sample; somatic mutation
Sites not aligning to the query:
- 3 modified: S-palmitoyl cysteine; C→S: Mild decrease of palmitoylation. Loss of localization to plasma membrane. Decreased cholesterol efflux. Decreased phospholipid efflux. Decreased palmitoylation; when associated with S-23, S-1110 and S-1111.
- 23 modified: S-palmitoyl cysteine; C→S: Mild decrease of palmitoylation. Loss of localization to plasma membrane. Decreased palmitoylation; when associated with S-3, S-1110 and S-1111.
- 74 I→C: 85-90% reduction in phospholipid and cholesterol efflux but no effect on localization to cell membrane; when associated with C-371.; I→K: 85-90% reduction in phospholipid and cholesterol efflux but no effect on localization to cell membrane; when associated with E-371.
- 75 modified: Disulfide link with 309
- 85 P → L: in FHA1; Alabama; dbSNP:rs145183203
- 98 modified: carbohydrate, N-linked (GlcNAc...) asparagine
- 100 S→C: Highly decreased protein abundance. Highly decreased ATPase activity. Highly decreased phospholipid translocase activity.
- 210 E → D: in a colorectal cancer sample; somatic mutation
- 219 R → K: in dbSNP:rs2230806
- 230 R → C: in dbSNP:rs9282541
- 244 modified: carbohydrate, N-linked (GlcNAc...) asparagine
- 248 P → A: in dbSNP:rs142625938
- 255 A → T: in TGD; deficient cellular cholesterol efflux; dbSNP:rs758100110
- 304 V→C: No effect on phospholipid and cholesterol efflux or localization to cell membrane; when associated with C-308.
- 308 V→C: No effect on phospholipid and cholesterol efflux or localization to cell membrane; when associated with C-304.
- 309 modified: Disulfide link with 75
- 364 S → C: in dbSNP:rs775035559
- 371 I→C: No effect on phospholipid and cholesterol efflux or localization to cell membrane. 85-90% reduction in phospholipid and cholesterol efflux but no effect on localization to cell membrane; when associated with C-74 or C-375.; I→E: 85-90% reduction in phospholipid and cholesterol efflux but no effect on localization to cell membrane; when associated with K-74.
- 375 L→C: 85-90% reduction in phospholipid and cholesterol efflux but no effect on localization to cell membrane; when associated with C-371.
- 399 V → A: in dbSNP:rs9282543
- 401 K → Q: in dbSNP:rs138487227
- 496 R → W: in dbSNP:rs147675550
- 568 K→A: 60-65% reduction in phospholipid and cholesterol efflux but no effect on localization to cell membrane.
- 573 Y→F: No effect on phospholipid and cholesterol efflux and on localization to cell membrane.
- 581 D→K: 80-85% reduction in phospholipid and cholesterol efflux but no effect on localization to cell membrane; when associated with K-584 and K-585.
- 583 F→K: 90-95% reduction in phospholipid and cholesterol efflux but no effect on localization to cell membrane; when associated with E-590.
- 584 E→K: 80-85% reduction in phospholipid and cholesterol efflux but no effect on localization to cell membrane; when associated with K-581 and K-585.
- 585 D→K: 80-85% reduction in phospholipid and cholesterol efflux but no effect on localization to cell membrane; when associated with K-581 and K-584.
- 590 W → S: in TGD; moderately decreased protein abundance; highly decreased ATPase activity; highly decreased phospholipid translocase activity; dbSNP:rs137854496; W→E: 90-95% reduction in phospholipid and cholesterol efflux but no effect on localization to cell membrane; when associated with K-583.
- 593 F→L: Moderately decreased protein abundance. Highly decreased ATPase activity. Highly decreased phospholipid translocase activity.
- 638 R → Q: in dbSNP:rs374190304
- 771 V → M: in dbSNP:rs2066718
- 774 T → P: in dbSNP:rs35819696; natural variant: T -> S
- 776 K → N: in dbSNP:rs138880920
- 815 E → G: in dbSNP:rs145582736
- 825 V → I: in dbSNP:rs2066715
- 883 I → M: in dbSNP:rs2066714
- 917 D → Y: in a colorectal cancer sample; somatic mutation
- 929 T → I: in TGD; moderately decreased protein abundance; highly decreased ATPase activity; highly decreased phospholipid translocase activity; loss protein subcellular localization to the plasma membrane
- 935 N → S: in TGD; moderately decreased protein abundance; highly decreased ATPase activity; highly decreased phospholipid translocase activity; dbSNP:rs28937313
- 939 K→M: Inhibits ATPase activity; when associated with M-1952. Decreases translocase activity; when associated with M-1952. Does not affect protein subcellular localization in plasma membrane and endosome; when associated with M-1952.
- 1042 modified: Phosphoserine; by PKA
- 1065 natural variant: P -> S
- 1091 M → T: in FHA1; loss of localization to plasma membrane; decreased cholesterol efflux; decreased phospholipid efflux
- 1110 modified: S-palmitoyl cysteine; C→S: Decreased palmitoylation; when associated with S-3, S-23 and S-1111.
- 1111 modified: S-palmitoyl cysteine; C→S: Decreased palmitoylation; when associated with S-3, S-23 and S-1110.
- 1172 E → D: in dbSNP:rs33918808
- 1181 S → F: in dbSNP:rs76881554
- 1216 G → V: in dbSNP:rs562403512
- 1341 R → T: in dbSNP:rs147743782
- 1376 S → G: in dbSNP:rs145689805
- 1379 L → F: in TGD; the mutant protein is retained in the endoplasmic reticulum while the wild-type protein is located at the plasma membrane
- 1407 A → T: in a colorectal cancer sample; somatic mutation; dbSNP:rs189206655
- 1463 modified: Disulfide link with 1477
- 1477 modified: Disulfide link with 1463; C → R: in TGD; loss of interaction with APOE; unable to generate APOE-containing high density lipoproteins; moderately decreased protein abundance; moderately decreased ATPase activity; moderately decreased phospholipid translocase activity; dbSNP:rs137854494
- 1512 T→M: Moderately decreased protein abundance. Does not affect ATPase activity. Moderately decreased phospholipid translocase activity.
- 1555 I → T: in dbSNP:rs1997618
- 1587 K → R: in dbSNP:rs2230808
- 1611 N → D: in FHA1; deficient cellular cholesterol efflux
- 1615 R → Q: in dbSNP:rs1251839800
- 1648 L → P: in dbSNP:rs1883024
- 1670 A → T: in dbSNP:rs1203589782
- 1680 R → Q: in dbSNP:rs150125857
- 1704 V → D: in TGD; the mutant protein is retained in the endoplasmic reticulum while the wild-type protein is located at the plasma membrane
- 1731 S → C: in dbSNP:rs760507032
- 1897 R → W: in FHA1; uncertain significance; dbSNP:rs760768125
- 2150 P → L: in FHA1; moderately decreased protein abundance; does not affect ATPase activity; moderately decreased phospholipid translocase activity; dbSNP:rs369098049
- 2163 natural variant: F -> S
- 2168 L → P: in dbSNP:rs2853577
- 2243 D → E: in dbSNP:rs34879708
- 2244 V → I: in dbSNP:rs144588452
6xjiC Pmtcd abc exporter at c1 symmetry (see paper)
24% identity, 92% coverage: 10:291/305 of query aligns to 6:272/290 of 6xjiC
- binding phosphothiophosphoric acid-adenylate ester: Y10 (= Y14), V15 (≠ A19), N35 (= N39), G36 (= G40), G38 (= G42), K39 (= K43), T40 (≠ S44), T41 (= T45), K115 (≠ R125), K119 (≠ G129), S121 (= S131)
- binding magnesium ion: T40 (≠ S44), E70 (= E82)
8eopA Cryo-em structure of nanodisc reconstituted human abca7 eq mutant in atp bound closed state (see paper)
34% identity, 69% coverage: 9:217/305 of query aligns to 1456:1671/1687 of 8eopA
Sites not aligning to the query:
- binding adenosine-5'-triphosphate: 659, 662, 666, 686, 687, 689, 690, 691, 692, 782, 784
8i6rB Cryo-em structure of pseudomonas aeruginosa ftse(e163q)x/envc complex with atp in peptidisc (see paper)
32% identity, 69% coverage: 3:211/305 of query aligns to 2:218/222 of 8i6rB
- binding adenosine-5'-triphosphate: Y11 (≠ K12), H15 (≠ A16), S37 (≠ N39), A39 (= A41), G40 (= G42), K41 (= K43), S42 (= S44), T43 (= T45), D137 (≠ G129), S139 (= S131), T140 (≠ V132), G141 (= G133), Q142 (≠ M134)
- binding magnesium ion: K41 (= K43), S42 (= S44)
7tbwA The structure of atp-bound abca1 (see paper)
32% identity, 70% coverage: 5:217/305 of query aligns to 1621:1840/1928 of 7tbwA
- binding adenosine-5'-triphosphate: Y1630 (= Y14), K1633 (≠ V17), N1657 (= N39), G1658 (= G40), G1660 (= G42), K1661 (= K43), S1662 (= S44), S1663 (≠ T45), Q1702 (vs. gap), N1753 (≠ G129), S1755 (= S131), G1756 (≠ V132), G1757 (= G133), Q1779 (≠ E155), G1783 (= G159), H1811 (= H188)
- binding magnesium ion: S1662 (= S44), Q1702 (vs. gap)
Sites not aligning to the query:
- binding adenosine-5'-triphosphate: 763, 765, 768, 790, 791, 793, 794, 795, 835, 887, 889, 944
- binding cholesterol: 218, 219, 360, 367
- binding magnesium ion: 835, 912, 913
F1MWM0 Retinal-specific phospholipid-transporting ATPase ABCA4; ATP-binding cassette sub-family A member 4; RIM ABC transporter; RIM protein; RmP; Retinal-specific ATP-binding cassette transporter; EC 7.6.2.1 from Bos taurus (Bovine) (see 2 papers)
32% identity, 69% coverage: 10:219/305 of query aligns to 1941:2157/2281 of F1MWM0
Sites not aligning to the query:
- 415 modified: carbohydrate, N-linked (Hex...) asparagine
- 504 modified: carbohydrate, N-linked (Hex...) asparagine
- 901 modified: Phosphothreonine; T→A: Decreases expression level. Affects subcellular location.
- 1185 modified: Phosphoserine; S→A: Does not affect subcellular location. Does not affect expression level. Does not affect ATPase activity. Reduces the stimulating effect of all-trans-retinal on ATP hydrolysis.
- 1309 Cleavage; by trypsin
- 1313 modified: Phosphothreonine; T→A: Does not affect subcellular location. Does not affect expression level. Does not affect ATPase activity. Reduces the stimulating effect of all-trans-retinal on ATP hydrolysis.
- 1317 modified: Phosphoserine; S→A: Does not affect subcellular location. Does not affect expression level. Affects both the basal and stimulated ATPase activity.
- 1319 modified: Phosphoserine
- 1455 modified: carbohydrate, N-linked (Hex...) asparagine
- 1527 modified: carbohydrate, N-linked (Hex...) asparagine
- 1660 modified: carbohydrate, N-linked (Hex...) asparagine
Query Sequence
>CCNA_01335 FitnessBrowser__Caulo:CCNA_01335
MSIALEAVGLTKTYGAVRALDDFSIAIPAGGVFGILGPNGAGKSTLFRIALGLVRPTSGS
ARLFGAAPGDITALRKVGAMIETPRYPPYLTARDTLKMLALESGKADADIGGWLERVSLT
HAADRATSGFSVGMKQRLGLAAAFLTKPELVILDEPTSGMDPAGIQEIRALIIDLAKIEG
VTVILASHQLDEVKRVCDRVAILSRGKVVAEGGVAELTAGEARLRLTLTSPLAPALAVLG
DRGEADGPDAVLADIPRAEAPALIRALVEAGVEIVEARWREVDLEGVYLKSLGQTPTAAT
AEGAA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory