Comparing CCNA_01572 FitnessBrowser__Caulo:CCNA_01572 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q92R43 Aquaglyceroporin AqpS from Rhizobium meliloti (strain 1021) (Ensifer meliloti) (Sinorhizobium meliloti) (see paper)
58% identity, 98% coverage: 1:219/224 of query aligns to 1:218/233 of Q92R43
P08995 Nodulin-26; N-26 from Glycine max (Soybean) (Glycine hispida) (see paper)
33% identity, 96% coverage: 8:221/224 of query aligns to 38:251/271 of P08995
Sites not aligning to the query:
Q6Z2T3 Aquaporin NIP2-1; Low silicon protein 1; NOD26-like intrinsic protein 2-1; OsNIP2;1; Silicon influx transporter LSI1 from Oryza sativa subsp. japonica (Rice) (see paper)
31% identity, 97% coverage: 8:224/224 of query aligns to 49:264/298 of Q6Z2T3
P30302 Aquaporin PIP2-3; Plasma membrane intrinsic protein 2-3; AtPIP2;3; Plasma membrane intrinsic protein 2c; PIP2c; RD28-PIP; TMP2C; Water stress-induced tonoplast intrinsic protein; WSI-TIP from Arabidopsis thaliana (Mouse-ear cress) (see paper)
32% identity, 61% coverage: 8:143/224 of query aligns to 37:184/285 of P30302
Sites not aligning to the query:
Q9SAI4 Aquaporin NIP6-1; NOD26-like intrinsic protein 6-1; AtNIP6;1 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
32% identity, 62% coverage: 8:146/224 of query aligns to 80:216/305 of Q9SAI4
Sites not aligning to the query:
P43286 Aquaporin PIP2-1; Plasma membrane intrinsic protein 2-1; AtPIP2;1; Plasma membrane intrinsic protein 2a; PIP2a from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
32% identity, 61% coverage: 8:143/224 of query aligns to 39:186/287 of P43286
Sites not aligning to the query:
P23645 Neurogenic protein big brain from Drosophila melanogaster (Fruit fly) (see 3 papers)
29% identity, 79% coverage: 43:220/224 of query aligns to 99:279/696 of P23645
Sites not aligning to the query:
P43287 Aquaporin PIP2-2; Plasma membrane intrinsic protein 2-2; AtPIP2;2; Plasma membrane intrinsic protein 2b; PIP2b; TMP2b from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
31% identity, 61% coverage: 8:143/224 of query aligns to 37:184/285 of P43287
Sites not aligning to the query:
Q9XF58 Aquaporin PIP2-5; Plasma membrane intrinsic protein 2-5; ZmPIP2-5; ZmPIP2;5; ZmPIP2a from Zea mays (Maize) (see paper)
30% identity, 61% coverage: 8:143/224 of query aligns to 37:186/285 of Q9XF58
8ct2D Local refinement of aqp1 tetramer (c1; refinement mask included d1 of protein 4.2 and ankyrin-1 ar1-5) in class 2 of erythrocyte ankyrin-1 complex (see paper)
31% identity, 69% coverage: 8:161/224 of query aligns to 10:174/247 of 8ct2D
Q54WT8 Aquaporin-B from Dictyostelium discoideum (Social amoeba) (see paper)
47% identity, 24% coverage: 48:100/224 of query aligns to 84:136/294 of Q54WT8
Sites not aligning to the query:
P61837 Aquaporin PIP1-1; AtPIP1;1; Plasma membrane aquaporin-1; Plasma membrane intrinsic protein 1a; PIP1a from Arabidopsis thaliana (Mouse-ear cress) (see paper)
39% identity, 42% coverage: 8:102/224 of query aligns to 52:146/286 of P61837
Sites not aligning to the query:
I1CR68 Aquaporin-1 from Rhizopus delemar (strain RA 99-880 / ATCC MYA-4621 / FGSC 9543 / NRRL 43880) (Mucormycosis agent) (Rhizopus arrhizus var. delemar) (see paper)
28% identity, 58% coverage: 8:136/224 of query aligns to 59:186/306 of I1CR68
Sites not aligning to the query:
3nkaA Crystal structure of aqpz h174g,t183f (see paper)
34% identity, 42% coverage: 8:100/224 of query aligns to 5:95/230 of 3nkaA
Sites not aligning to the query:
P60844 Aquaporin Z; Bacterial nodulin-like intrinsic protein; Water channel AqpZ from Escherichia coli (strain K12) (see paper)
34% identity, 42% coverage: 8:100/224 of query aligns to 3:93/231 of P60844
Sites not aligning to the query:
Q06611 Aquaporin PIP1-2; AtPIP1;2; Plasma membrane intrinsic protein 1b; PIP1b; Transmembrane protein A; AthH2; TMP-A from Arabidopsis thaliana (Mouse-ear cress) (see paper)
38% identity, 42% coverage: 8:102/224 of query aligns to 52:146/286 of Q06611
Sites not aligning to the query:
2o9eA Crystal structure of aqpz mutant t183c complexed with mercury (see paper)
34% identity, 42% coverage: 8:100/224 of query aligns to 5:95/232 of 2o9eA
Sites not aligning to the query:
Q39196 Probable aquaporin PIP1-4; Plasma membrane intrinsic protein 1-4; AtPIP1;4; Transmembrane protein C; TMP-C from Arabidopsis thaliana (Mouse-ear cress) (see paper)
35% identity, 42% coverage: 8:102/224 of query aligns to 53:147/287 of Q39196
Sites not aligning to the query:
Q08733 Aquaporin PIP1-3; AtPIP1;3; Plasma membrane intrinsic protein 1c; PIP1c; Transmembrane protein B; TMP-B from Arabidopsis thaliana (Mouse-ear cress) (see paper)
29% identity, 64% coverage: 1:143/224 of query aligns to 45:193/286 of Q08733
Sites not aligning to the query:
O94778 Aquaporin-8; AQP-8 from Homo sapiens (Human) (see 4 papers)
42% identity, 40% coverage: 13:102/224 of query aligns to 41:124/261 of O94778
Sites not aligning to the query:
>CCNA_01572 FitnessBrowser__Caulo:CCNA_01572
MSPFDTPRRLVAEALGTALLLAVVVGSGIMGERLSDGNIAIALLGNTLATGAALVVLIWV
FGPISGAHFNPAVTLVAALRRELPLTLALAYPLAQILGGIAGVWTAHAMFGEPILQVSTK
LRSGGDQAFAEVVATFGLLATILGVSRFRPESTPMAVGLYITAAYWFTASTSFANPAVTV
ARSLSDSFAGIAPASAPAFILAQLVGALSAAALFGWLLKTDTSR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory