Comparing CCNA_01843 FitnessBrowser__Caulo:CCNA_01843 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3cuxA Atomic resolution structures of escherichia coli and bacillis anthracis malate synthase a: comparison with isoform g and implications for structure based drug design (see paper)
57% identity, 98% coverage: 10:525/525 of query aligns to 1:501/501 of 3cuxA
3cv1A Atomic resolution structures of escherichia coli and bacillis anthracis malate synthase a: comparison with isoform g and implications for structure based drug design (see paper)
54% identity, 98% coverage: 12:525/525 of query aligns to 10:528/529 of 3cv1A
3cuzA Atomic resolution structures of escherichia coli and bacillis anthracis malate synthase a: comparison with isoform g and implications for structure based drug design (see paper)
54% identity, 98% coverage: 12:525/525 of query aligns to 10:528/529 of 3cuzA
3cv2A Atomic resolution structures of escherichia coli and bacillis anthracis malate synthase a: comparison with isoform g and implications for structure based drug design (see paper)
54% identity, 98% coverage: 12:525/525 of query aligns to 5:523/524 of 3cv2A
P30952 Malate synthase 1; EC 2.3.3.9 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
47% identity, 97% coverage: 14:523/525 of query aligns to 23:539/554 of P30952
Sites not aligning to the query:
5cahA Crystal structure of mycobacterium tuberculosis malate synthase in complex with 6h-thieno[2,3-b]pyrrole-5-carboxylic acid (see paper)
24% identity, 72% coverage: 85:463/525 of query aligns to 237:630/706 of 5cahA
4ex4B The structure of glcb from mycobacterium leprae
26% identity, 75% coverage: 93:484/525 of query aligns to 247:669/721 of 4ex4B
4ex4A The structure of glcb from mycobacterium leprae
24% identity, 81% coverage: 64:487/525 of query aligns to 166:635/684 of 4ex4A
6axbA Crystal structure of mycobacterium tuberculosis malate synthase in complex with 2-naphthyldiketoacid (see paper)
22% identity, 79% coverage: 85:500/525 of query aligns to 241:677/715 of 6axbA
Sites not aligning to the query:
3s9zA Crystal structure of mycobacterium tuberculosis malate synthase in complex with 4-(2-bromophenyl)-2,4-dioxobutanoic acid inhibitor (see paper)
22% identity, 79% coverage: 85:500/525 of query aligns to 241:677/715 of 3s9zA
Sites not aligning to the query:
3s9iA Crystal structure of mycobacterium tuberculosis malate synthase in complex with 2-4-dioxo-4-phenylbutanoic acid inhibitor (see paper)
23% identity, 79% coverage: 85:500/525 of query aligns to 241:676/714 of 3s9iA
5cjmA Crystal structure of mycobacterium tuberculosis malate synthase in complex with 4h-thieno[3,2-b]pyrrole-5-carboxylic acid (see paper)
24% identity, 72% coverage: 85:463/525 of query aligns to 241:635/711 of 5cjmA
Sites not aligning to the query:
5cc6A Crystal structure of mycobacterium tuberculosis malate synthase in complex with 1h-indole-5-carboxylic acid
24% identity, 72% coverage: 85:463/525 of query aligns to 235:629/701 of 5cc6A
Sites not aligning to the query:
5cc7A Crystal structure of mycobacterium tuberculosis malate synthase in complex with 1h-indole-6-carboxylic acid
24% identity, 72% coverage: 85:463/525 of query aligns to 238:632/704 of 5cc7A
Sites not aligning to the query:
1n8iA Biochemical and structural studies of malate synthase from mycobacterium tuberculosis (see paper)
24% identity, 72% coverage: 85:463/525 of query aligns to 235:629/701 of 1n8iA
5e9xA Crystal structure of mycobacterium tuberculosis malate synthase in complex with 2-chloro-6h-thieno[2,3-b]pyrrole-5-carboxylic acid (see paper)
22% identity, 72% coverage: 85:463/525 of query aligns to 238:639/715 of 5e9xA
Sites not aligning to the query:
3sb0A Crystal structure of mycobacterium tuberculosis malate synthase in complex with 4-(2-chloro-6-fluoro-3-methylphenyl)-2,4-dioxobutanoic acid inhibitor (see paper)
24% identity, 72% coverage: 85:463/525 of query aligns to 237:632/708 of 3sb0A
Sites not aligning to the query:
6c7bA Crystal structure of mycobacterium tuberculosis malate synthase in complex with methoxynaphthyldiketoacid (see paper)
24% identity, 72% coverage: 85:463/525 of query aligns to 241:636/710 of 6c7bA
5ecvA Crystal structure of mycobacterium tuberculosis malate synthase in complex with 2-hydroxy-4-(4-methyl-1h-indol-5-yl)-4-oxobut-2-enoic acid (see paper)
23% identity, 72% coverage: 85:463/525 of query aligns to 241:640/713 of 5ecvA
6c2xA Crystal structure of mycobacterium tuberculosis malate synthase in complex with 2-br-6-me-phenyldiketoacid (see paper)
24% identity, 72% coverage: 85:463/525 of query aligns to 239:635/711 of 6c2xA
Sites not aligning to the query:
>CCNA_01843 FitnessBrowser__Caulo:CCNA_01843
MPLDIAANIQVTAPVEGRAAEVLTPEALAFVADLHRRFDARRRQLLEARQARQARFDAGE
LPDFLDETASIRSADWTIAAIPSDLLDRRVEITGPVNRKMIINALNCGAKVFMADFEDAT
APTWANVVEGQINLKDRWQGELTHVDAKSGKAYAMGPTSAVLKIRPRGWHLMERHLEVDG
QAVAGALFDFGLYAFHNAKAAIAKGSGPYFYLPKLESHLEARLWNDVFIRAQEVLDLPVG
TIKATVLIETIPAAFEMDEILFELKDHIVGLNCGRWDYIFSFIKRLGRREAFLTPDRSAM
VMGKAFLGAYSLKLIQTCHRRGAFAMGGMAAQIPVKGDEAANNAAFAKVRADKEREAGAG
HDGTWVAHPDLVPVAMEVFNRLMPTPNQLDRKLDDLSITQAQMLELHEGSRTEAGVRENI
RVGVRYTQAWIEGRGAVPLYNLMEDAATAEICRTQLWQWVRLGAALDDGRVLSSELFVSL
FSQEMSDLRREFASPRLEEAAHIFTRMVLSDDLEEFLTIPAYELL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory