Comparing Dsui_0019 FitnessBrowser__PS:Dsui_0019 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3cuxA Atomic resolution structures of escherichia coli and bacillis anthracis malate synthase a: comparison with isoform g and implications for structure based drug design (see paper)
53% identity, 98% coverage: 10:531/532 of query aligns to 1:501/501 of 3cuxA
P30952 Malate synthase 1; EC 2.3.3.9 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
49% identity, 96% coverage: 22:532/532 of query aligns to 31:542/554 of P30952
Sites not aligning to the query:
3cv1A Atomic resolution structures of escherichia coli and bacillis anthracis malate synthase a: comparison with isoform g and implications for structure based drug design (see paper)
46% identity, 98% coverage: 9:532/532 of query aligns to 7:529/529 of 3cv1A
3cuzA Atomic resolution structures of escherichia coli and bacillis anthracis malate synthase a: comparison with isoform g and implications for structure based drug design (see paper)
46% identity, 98% coverage: 9:532/532 of query aligns to 7:529/529 of 3cuzA
3cv2A Atomic resolution structures of escherichia coli and bacillis anthracis malate synthase a: comparison with isoform g and implications for structure based drug design (see paper)
46% identity, 98% coverage: 9:532/532 of query aligns to 2:524/524 of 3cv2A
1p7tA Structure of escherichia coli malate synthase g:pyruvate:acetyl- coenzyme a abortive ternary complex at 1.95 angstrom resolution (see paper)
24% identity, 59% coverage: 178:489/532 of query aligns to 337:650/706 of 1p7tA
Sites not aligning to the query:
1d8cA Malate synthase g complexed with magnesium and glyoxylate (see paper)
24% identity, 59% coverage: 178:489/532 of query aligns to 340:653/709 of 1d8cA
Sites not aligning to the query:
P37330 Malate synthase G; MSG; EC 2.3.3.9 from Escherichia coli (strain K12) (see 2 papers)
24% identity, 59% coverage: 178:489/532 of query aligns to 353:666/723 of P37330
Sites not aligning to the query:
3s9iA Crystal structure of mycobacterium tuberculosis malate synthase in complex with 2-4-dioxo-4-phenylbutanoic acid inhibitor (see paper)
22% identity, 72% coverage: 109:489/532 of query aligns to 264:664/714 of 3s9iA
5cakA Crystal structure of mycobacterium tuberculosis malate synthase in complex with 2-hydroxy-3-(1h-indol-3-yl)propanoic acid (see paper)
22% identity, 66% coverage: 109:460/532 of query aligns to 264:638/717 of 5cakA
Sites not aligning to the query:
3sadA Crystal structure of mycobacterium tuberculosis malate synthase in complex with 4-(2-mehtylphenyl)-2,4-dioxobutanoic acid inhibitor (see paper)
22% identity, 66% coverage: 109:460/532 of query aligns to 261:632/709 of 3sadA
5cahA Crystal structure of mycobacterium tuberculosis malate synthase in complex with 6h-thieno[2,3-b]pyrrole-5-carboxylic acid (see paper)
22% identity, 66% coverage: 109:460/532 of query aligns to 260:627/706 of 5cahA
5cjnA Crystal structure of mycobacterium tuberculosis malate synthase in complex with 3-(3-oxo-3,4-dihydroquinoxalin-2-yl)acrylate (see paper)
22% identity, 66% coverage: 109:460/532 of query aligns to 259:633/712 of 5cjnA
Sites not aligning to the query:
5cbbA Crystal structure of mycobacterium tuberculosis malate synthase in complex with 5-(3h-indol-3-ylidene)-2,5-dihydro-1h-pyrazole-3- carboxylate (see paper)
22% identity, 66% coverage: 109:460/532 of query aligns to 260:634/713 of 5cbbA
Sites not aligning to the query:
6ba7A Crystal structure of mycobacterium tuberculosis malate synthase in complex with 2-cl-4-oh-phenyldiketoacid (see paper)
22% identity, 66% coverage: 109:460/532 of query aligns to 262:633/709 of 6ba7A
Sites not aligning to the query:
1n8iA Biochemical and structural studies of malate synthase from mycobacterium tuberculosis (see paper)
23% identity, 66% coverage: 109:460/532 of query aligns to 258:626/701 of 1n8iA
6dljA Crystal structure of mycobacterium tuberculosis malate synthase in complex with 2-nitro-phenyldiketoacid (see paper)
23% identity, 66% coverage: 109:460/532 of query aligns to 259:628/704 of 6dljA
Sites not aligning to the query:
6c8pA Crystal structure of mycobacterium tuberculosis malate synthase in complex with 2-f-phenyldiketoacid (see paper)
22% identity, 66% coverage: 109:460/532 of query aligns to 264:637/716 of 6c8pA
6dnpA Crystal structure of mycobacterium tuberculosis malate synthase in complex with 2-f-3-methyl-6-f-phenyldiketoacid (see paper)
23% identity, 66% coverage: 109:460/532 of query aligns to 264:633/712 of 6dnpA
3sazA Crystal structure of mycobacterium tuberculosis malate synthase in complex with 4-(3-bromophenyl)-2,4-dioxobutanoic acid inhibitor (see paper)
21% identity, 74% coverage: 109:503/532 of query aligns to 264:677/712 of 3sazA
>Dsui_0019 FitnessBrowser__PS:Dsui_0019
MSLNLPAGMQITAPIQPQYESILTLEALEFVAKLHRAFEGRRQELLKARVERQARIDAGE
MPDFLPETKHIREGDWKVAPLPAALERRRTEITGPVEAKMIINAFNSGADSYMTDFEDSN
SPNWDNQIQGQVNLYQAIRRQLSFKNEAGKEYKLNDQIATLQIRPRGWHLDEKHVTVDGQ
RVAGGIFDFALVFFHNAKEQIARGAGPFYYLPKMESHLEARLWNDIFVMAQDHIGLPQGT
IKATVLVETILATFEMEEILYELRNHSAGLNAGRWDYIFSCIKKFKKNKDFCLAQRGVIT
MEVPFMRSYALALVQACHKRGAPAMGGMSALIPIKNDPVANEKALAGIRHDKARDAKDGF
DGGWVAHPGLVSIAHEEFVKVLGDKPNQWEKQVEGSFGPKDWLNFQPEQPITEAGLRNNI
NVGIHYLGSWLAGNGCVPIHNLMEDAATAEISRSQVWQWVVSPKGILDDGRKVTVEMVRP
MIAEELAKVKATVAAQGEDTATYDQAAVIFDKMSLTPDYPEFLTLPLYEAMA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory