SitesBLAST
Comparing Dsui_0694 FitnessBrowser__PS:Dsui_0694 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4clhA Crystal structure of pteridine reductase 1 (ptr1) from trypanosoma brucei in ternary complex with cofactor and inhibitor (see paper)
43% identity, 95% coverage: 8:246/251 of query aligns to 1:246/252 of 4clhA
- active site: R13 (= R20), D145 (= D146), Y158 (= Y159), K162 (= K163)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R13 (= R20), I14 (≠ V21), H32 (= H39), Y33 (= Y40), H34 (≠ R41), N35 (≠ S42), S36 (≠ A43), D61 (= D68), L62 (= L69), N92 (= N95), A93 (= A96), S94 (= S97), T117 (≠ S118), L143 (≠ I144), K162 (= K163), P188 (= P188), G189 (= G189), S191 (≠ I191)
- binding 4-thiomorpholino-7H-pyrrolo[2,3-d]pyrimidin-2-amine: S94 (= S97), F96 (= F99), F96 (= F99), D145 (= D146), C152 (≠ L153), F155 (≠ Y156), Y158 (= Y159), P194 (= P194), W205 (≠ A203)
4cleA Crystal structure of pteridine reductase 1 (ptr1) from trypanosoma brucei in ternary complex with cofactor and inhibitor (see paper)
43% identity, 95% coverage: 8:246/251 of query aligns to 1:246/252 of 4cleA
- active site: R13 (= R20), D145 (= D146), Y158 (= Y159), K162 (= K163)
- binding 4-(pyrrolidin-1-yl)-7H-pyrrolo[2,3-d]pyrimidin-2-amine: S94 (= S97), F96 (= F99), F96 (= F99), D145 (= D146), C152 (≠ L153), Y158 (= Y159), G189 (= G189), P194 (= P194), W205 (≠ A203)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R13 (= R20), I14 (≠ V21), Y33 (= Y40), H34 (≠ R41), N35 (≠ S42), S36 (≠ A43), L62 (= L69), N92 (= N95), A93 (= A96), S94 (= S97), T117 (≠ S118), K162 (= K163), P188 (= P188), S191 (≠ I191)
6rx6A Trypanosoma brucei ptr1 (tbptr1) in complex with inhibitor 4 (nmt- c0026) (see paper)
44% identity, 95% coverage: 8:246/251 of query aligns to 1:242/248 of 6rx6A
- active site: R13 (= R20), D141 (= D146), Y154 (= Y159), K158 (= K163)
- binding methyl 1-[4-[[2,4-bis(azanyl)pteridin-6-yl]methyl-(3-oxidanylpropyl)amino]phenyl]carbonylpiperidine-4-carboxylate: R13 (= R20), S94 (= S97), F96 (= F99), Y154 (= Y159), P190 (= P194), M193 (≠ E195), W201 (≠ A203)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R13 (= R20), I14 (≠ V21), Y33 (= Y40), H34 (≠ R41), N35 (≠ S42), S36 (≠ A43), L62 (= L69), N92 (= N95), A93 (= A96), S94 (= S97), T115 (≠ S118), L139 (≠ I144), K158 (= K163), P184 (= P188), G185 (= G189), S187 (≠ I191)
6rx0A Trypanosoma brucei ptr1 (tbptr1) in complex with inhibitor 3 (nmt- c0013) (see paper)
44% identity, 95% coverage: 8:246/251 of query aligns to 1:242/248 of 6rx0A
- active site: R13 (= R20), D141 (= D146), Y154 (= Y159), K158 (= K163)
- binding methyl 1-[4-[[2,4-bis(azanyl)pteridin-6-yl]methyl-ethyl-amino]phenyl]carbonylpiperidine-4-carboxylate: R13 (= R20), S94 (= S97), F96 (= F99), P98 (≠ R101), F151 (≠ Y156), Y154 (= Y159), P190 (= P194), M193 (≠ E195), W201 (≠ A203)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R13 (= R20), I14 (≠ V21), Y33 (= Y40), H34 (≠ R41), N35 (≠ S42), S36 (≠ A43), L62 (= L69), N92 (= N95), A93 (= A96), S94 (= S97), T115 (≠ S118), L139 (≠ I144), K158 (= K163), P184 (= P188), S187 (≠ I191)
6howA Trypanosoma brucei ptr1 in complex with the triazine inhibitor 2a (f219). (see paper)
44% identity, 95% coverage: 8:246/251 of query aligns to 1:242/248 of 6howA
- active site: R13 (= R20), D141 (= D146), Y154 (= Y159), K158 (= K163)
- binding (2~{R})-1-(3,4-dichlorophenyl)-2-(4-nitrophenyl)-2~{H}-1,3,5-triazine-4,6-diamine: S94 (= S97), F96 (= F99), Y154 (= Y159), L189 (≠ W193), P190 (= P194)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R13 (= R20), I14 (≠ V21), Y33 (= Y40), H34 (≠ R41), N35 (≠ S42), S36 (≠ A43), D61 (= D68), L62 (= L69), N92 (= N95), A93 (= A96), S94 (= S97), T115 (≠ S118), L139 (≠ I144), D141 (= D146), K158 (= K163), G185 (= G189), V186 (≠ P190), S187 (≠ I191)
6gexA Trypanosoma brucei ptr1 in complex with inhibitor 2h (f246) (see paper)
44% identity, 95% coverage: 8:246/251 of query aligns to 1:242/248 of 6gexA
- active site: R13 (= R20), D141 (= D146), Y154 (= Y159), K158 (= K163)
- binding 4-[(2-azanyl-1,3-benzothiazol-6-yl)sulfanylmethyl]-~{N}-(phenylmethyl)benzamide: S94 (= S97), F96 (= F99), C148 (≠ L153), Y154 (= Y159), P190 (= P194), M193 (≠ E195), W201 (≠ A203)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R13 (= R20), I14 (≠ V21), Y33 (= Y40), H34 (≠ R41), N35 (≠ S42), S36 (≠ A43), D61 (= D68), L62 (= L69), N92 (= N95), S94 (= S97), T115 (≠ S118), L139 (≠ I144), K158 (= K163), P184 (= P188), G185 (= G189), S187 (≠ I191), L188 (= L192)
6gdoA Trypanosoma brucei ptr1 in complex with inhibitor 2g (f240) (see paper)
44% identity, 95% coverage: 8:246/251 of query aligns to 1:242/248 of 6gdoA
- active site: R13 (= R20), D141 (= D146), Y154 (= Y159), K158 (= K163)
- binding methyl 1-[4-[(2-azanyl-1,3-benzothiazol-6-yl)sulfanylmethyl]phenyl]carbonylpiperidine-4-carboxylate: S94 (= S97), F96 (= F99), C148 (≠ L153), Y154 (= Y159), M193 (≠ E195), W201 (≠ A203)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R13 (= R20), I14 (≠ V21), Y33 (= Y40), H34 (≠ R41), N35 (≠ S42), S36 (≠ A43), D61 (= D68), L62 (= L69), N92 (= N95), A93 (= A96), S94 (= S97), T115 (≠ S118), L139 (≠ I144), D141 (= D146), K158 (= K163), P184 (= P188), G185 (= G189), S187 (≠ I191), L188 (= L192)
5k6aA Trypanosoma brucei pteridine reductase 1 (ptr1) in complex with compound 1 (see paper)
44% identity, 95% coverage: 8:246/251 of query aligns to 1:242/248 of 5k6aA
- active site: R13 (= R20), D141 (= D146), Y154 (= Y159), K158 (= K163)
- binding (2~{R})-2-(3-hydroxyphenyl)-6-oxidanyl-2,3-dihydrochromen-4-one: S94 (= S97), F96 (= F99), Y154 (= Y159), V186 (≠ P190), P190 (= P194), W201 (≠ A203)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R13 (= R20), I14 (≠ V21), Y33 (= Y40), H34 (≠ R41), N35 (≠ S42), S36 (≠ A43), D61 (= D68), L62 (= L69), N92 (= N95), A93 (= A96), S94 (= S97), T115 (≠ S118), L139 (≠ I144), D141 (= D146), K158 (= K163), G185 (= G189), S187 (≠ I191), L188 (= L192)
2x9nA High resolution structure of tbptr1 in complex with cyromazine (see paper)
44% identity, 95% coverage: 8:246/251 of query aligns to 1:242/248 of 2x9nA
- active site: R13 (= R20), D141 (= D146), Y154 (= Y159), K158 (= K163)
- binding N~2~-cyclopropyl-1,3,5-triazine-2,4,6-triamine: R13 (= R20), S94 (= S97), F96 (= F99), Y154 (= Y159), L188 (= L192), P190 (= P194)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R13 (= R20), I14 (≠ V21), Y33 (= Y40), H34 (≠ R41), N35 (≠ S42), S36 (≠ A43), D61 (= D68), L62 (= L69), N92 (= N95), A93 (= A96), S94 (= S97), T115 (≠ S118), L139 (≠ I144), C140 (≠ T145), K158 (= K163), P184 (= P188), G185 (= G189), S187 (≠ I191)
5izcC Trypanosoma brucei ptr1 in complex with inhibitor f032 (see paper)
44% identity, 96% coverage: 7:246/251 of query aligns to 1:235/241 of 5izcC
- active site: R14 (= R20), D142 (= D146), Y155 (= Y159), K159 (= K163)
- binding N~2~-[(thiophen-2-yl)methyl]-1,3,4-thiadiazole-2,5-diamine: S95 (= S97), F97 (= F99), C149 (≠ L153), Y155 (= Y159), V187 (≠ P190), L190 (≠ W193), P191 (= P194), W194 (≠ A202)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R14 (= R20), I15 (≠ V21), H33 (= H39), Y34 (= Y40), H35 (≠ R41), N36 (≠ S42), S37 (≠ A43), D62 (= D68), L63 (= L69), N93 (= N95), A94 (= A96), S95 (= S97), T116 (≠ S118), L140 (≠ I144), K159 (= K163), G186 (= G189), V187 (≠ P190), S188 (≠ I191)
3jq8A Crystal structure of pteridine reductase 1 (ptr1) from trypanosoma brucei in ternary complex with cofactor (NADP+) and inhibitor 6,7,7- trimethyl-7,8-dihydropteridine-2,4-diamine (dx3) (see paper)
44% identity, 95% coverage: 8:246/251 of query aligns to 1:242/248 of 3jq8A
- active site: R13 (= R20), D142 (= D146), Y155 (= Y159), K159 (= K163)
- binding 6,7,7-trimethyl-7,8-dihydropteridine-2,4-diamine: S94 (= S97), F96 (= F99), Y155 (= Y159)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R13 (= R20), I14 (≠ V21), H32 (= H39), Y33 (= Y40), H34 (≠ R41), N35 (≠ S42), S36 (≠ A43), D61 (= D68), L62 (= L69), N92 (= N95), A93 (= A96), S94 (= S97), T116 (≠ S118), C141 (≠ T145), D142 (= D146), K159 (= K163), P185 (= P188), G186 (= G189), S188 (≠ I191)
5jdcA Trypanosoma brucei ptr1 in complex with inhibitor np-13 (hesperetin) (see paper)
44% identity, 95% coverage: 8:246/251 of query aligns to 1:243/249 of 5jdcA
- active site: R13 (= R20), D142 (= D146), Y155 (= Y159), K159 (= K163)
- binding (2S)-5,7-dihydroxy-2-(3-hydroxy-4-methoxyphenyl)-2,3-dihydro-4H-1-benzopyran-4-one: F96 (= F99), D142 (= D146), M144 (≠ H148), C149 (≠ L153), L189 (= L192), L190 (≠ W193), P191 (= P194), W202 (≠ A203)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R13 (= R20), I14 (≠ V21), Y33 (= Y40), H34 (≠ R41), N35 (≠ S42), S36 (≠ A43), D61 (= D68), L62 (= L69), N92 (= N95), S94 (= S97), T116 (≠ S118), L140 (≠ I144), K159 (= K163), G186 (= G189), S188 (≠ I191), L189 (= L192)
5jcxA Trypanosoma brucei ptr1 in complex with inhibitor np-29 (see paper)
44% identity, 95% coverage: 8:246/251 of query aligns to 1:243/249 of 5jcxA
- active site: R13 (= R20), D142 (= D146), Y155 (= Y159), K159 (= K163)
- binding 3,5,7-trihydroxy-2-(2-hydroxyphenyl)-4H-1-benzopyran-4-one: F96 (= F99), Y155 (= Y159), P191 (= P194), M194 (≠ E195), W202 (≠ A203)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R13 (= R20), I14 (≠ V21), H32 (= H39), Y33 (= Y40), H34 (≠ R41), N35 (≠ S42), S36 (≠ A43), D61 (= D68), L62 (= L69), N92 (= N95), A93 (= A96), S94 (= S97), T116 (≠ S118), L140 (≠ I144), K159 (= K163), P185 (= P188), G186 (= G189), S188 (≠ I191), L189 (= L192)
5jcjA Trypanosoma brucei ptr1 in complex with inhibitor nmt-h037 (compound 7) (see paper)
44% identity, 95% coverage: 8:246/251 of query aligns to 1:243/249 of 5jcjA
- active site: R13 (= R20), D142 (= D146), Y155 (= Y159), K159 (= K163)
- binding 2-(3,4-dihydroxyphenyl)-3,6-dihydroxy-4H-1-benzopyran-4-one: S94 (= S97), F96 (= F99), Y155 (= Y159), L189 (= L192), L190 (≠ W193), W202 (≠ A203)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R13 (= R20), I14 (≠ V21), H32 (= H39), Y33 (= Y40), H34 (≠ R41), N35 (≠ S42), S36 (≠ A43), D61 (= D68), L62 (= L69), N92 (= N95), A93 (= A96), S94 (= S97), T116 (≠ S118), L140 (≠ I144), D142 (= D146), K159 (= K163), G186 (= G189), S188 (≠ I191), L189 (= L192)
5izcA Trypanosoma brucei ptr1 in complex with inhibitor f032 (see paper)
44% identity, 95% coverage: 8:246/251 of query aligns to 1:243/249 of 5izcA
- active site: R13 (= R20), D142 (= D146), Y155 (= Y159), K159 (= K163)
- binding N~2~-[(thiophen-2-yl)methyl]-1,3,4-thiadiazole-2,5-diamine: S94 (= S97), F96 (= F99), C149 (≠ L153), Y155 (= Y159), V187 (≠ P190), L190 (≠ W193), P191 (= P194)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: K12 (= K19), R13 (= R20), I14 (≠ V21), Y33 (= Y40), H34 (≠ R41), N35 (≠ S42), S36 (≠ A43), D61 (= D68), L62 (= L69), N92 (= N95), A93 (= A96), S94 (= S97), T116 (≠ S118), L140 (≠ I144), K159 (= K163), P185 (= P188), G186 (= G189), S188 (≠ I191), L189 (= L192)
4wcfA Trypanosoma brucei ptr1 in complex with inhibitor 9 (see paper)
44% identity, 95% coverage: 8:246/251 of query aligns to 1:243/249 of 4wcfA
- active site: R13 (= R20), D142 (= D146), Y155 (= Y159), K159 (= K163)
- binding 3-(5-amino-1,3,4-thiadiazol-2-yl)pyridin-4-amine: S94 (= S97), F96 (= F99), Y155 (= Y159), P191 (= P194)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R13 (= R20), I14 (≠ V21), Y33 (= Y40), H34 (≠ R41), N35 (≠ S42), S36 (≠ A43), D61 (= D68), L62 (= L69), N92 (= N95), A93 (= A96), S94 (= S97), T116 (≠ S118), L140 (≠ I144), C141 (≠ T145), D142 (= D146), K159 (= K163), G186 (= G189), V187 (≠ P190), S188 (≠ I191)
4cmeA Crystal structure of pteridine reductase 1 (ptr1) from trypanosoma brucei in ternary complex with cofactor and inhibitor (see paper)
44% identity, 95% coverage: 8:246/251 of query aligns to 1:243/249 of 4cmeA
- active site: R13 (= R20), D142 (= D146), Y155 (= Y159), K159 (= K163)
- binding N4,N4-dimethyl-5,6-diphenyl-7H-pyrrolo[2,3-d]pyrimidine-2,4-diamine: S94 (= S97), F96 (= F99), M144 (≠ H148), C149 (≠ L153), Y155 (= Y159), G186 (= G189), L190 (≠ W193)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R13 (= R20), I14 (≠ V21), H34 (≠ R41), N35 (≠ S42), S36 (≠ A43), D61 (= D68), L62 (= L69), N92 (= N95), A93 (= A96), S94 (= S97), T116 (≠ S118), L140 (≠ I144), D142 (= D146), K159 (= K163), P185 (= P188), V187 (≠ P190), S188 (≠ I191)
4cm9A Crystal structure of pteridine reductase 1 (ptr1) from trypanosoma brucei in ternary complex with cofactor and inhibitor (see paper)
44% identity, 95% coverage: 8:246/251 of query aligns to 1:243/249 of 4cm9A
- active site: R13 (= R20), D142 (= D146), Y155 (= Y159), K159 (= K163)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R13 (= R20), I14 (≠ V21), Y33 (= Y40), H34 (≠ R41), N35 (≠ S42), S36 (≠ A43), L62 (= L69), N92 (= N95), A93 (= A96), S94 (= S97), T116 (≠ S118), L140 (≠ I144), K159 (= K163), P185 (= P188), G186 (= G189), V187 (≠ P190), S188 (≠ I191)
- binding 2-amino-5,6-diphenyl-3H-pyrrolo[2,3-d]pyrimidin-4(7H)-one: S94 (= S97), F96 (= F99), D142 (= D146), M144 (≠ H148), C149 (≠ L153), Y155 (= Y159), G186 (= G189), L190 (≠ W193), P191 (= P194), M194 (≠ E195)
3jqgA Crystal structure of pteridine reductase 1 (ptr1) from trypanosoma brucei in ternary complex with cofactor (NADP+) and inhibitor 6-[(4- methoxybenzyl)sulfanyl]pyrimidine-2,4-diamine (ax6) (see paper)
44% identity, 95% coverage: 8:246/251 of query aligns to 1:243/249 of 3jqgA
- active site: R13 (= R20), D142 (= D146), Y155 (= Y159), K159 (= K163)
- binding 6-[(4-methoxybenzyl)sulfanyl]pyrimidine-2,4-diamine: R13 (= R20), S94 (= S97), F96 (= F99), Y155 (= Y159), P191 (= P194), W202 (≠ A203)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R13 (= R20), I14 (≠ V21), Y33 (= Y40), H34 (≠ R41), N35 (≠ S42), S36 (≠ A43), L62 (= L69), N92 (= N95), S94 (= S97), T116 (≠ S118), L140 (≠ I144), C141 (≠ T145), K159 (= K163), P185 (= P188), G186 (= G189), V187 (≠ P190), S188 (≠ I191)
3jqfA Crystal structure of pteridine reductase 1 (ptr1) from trypanosoma brucei in ternary complex with cofactor (NADP+) and inhibitor 1,3,5- triazine-2,4,6-triamine (ax2) (see paper)
44% identity, 95% coverage: 8:246/251 of query aligns to 1:243/249 of 3jqfA
- active site: R13 (= R20), D142 (= D146), Y155 (= Y159), K159 (= K163)
- binding 1,3,5-triazine-2,4,6-triamine: S94 (= S97), F96 (= F99), Y155 (= Y159)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R13 (= R20), I14 (≠ V21), H32 (= H39), H34 (≠ R41), N35 (≠ S42), S36 (≠ A43), D61 (= D68), L62 (= L69), N92 (= N95), A93 (= A96), S94 (= S97), T116 (≠ S118), L140 (≠ I144), K159 (= K163), P185 (= P188), G186 (= G189), S188 (≠ I191), L189 (= L192)
Query Sequence
>Dsui_0694 FitnessBrowser__PS:Dsui_0694
MDSNGNLQGKAILVTGGAKRVGAAIARRLHAAGASLVLHYRSAAAEARSLAAELNAQRDG
SAVCIQADLLQTSALPGLVEQSVTAFGRLDGLVNNASSFFRTPLGSIDEAAWDDLVGSNF
KAPLFLTQAAAPHLRASGGAVVNITDVHAERPLVGYPLYCAAKGALLTLTRALAAELAPV
VRVNAVAPGPILWPEGSDFDSAARQAIVADTLLGREGSPADIARAVHFLLVDSPYITGQV
INVDGGRTAHL
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory