Comparing Dsui_1232 FitnessBrowser__PS:Dsui_1232 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2hzlB Crystal structures of a sodium-alpha-keto acid binding subunit from a trap transporter in its closed forms (see paper)
56% identity, 91% coverage: 32:362/362 of query aligns to 2:332/337 of 2hzlB
Q3J1R2 Alpha-keto acid-binding periplasmic protein TakP; Extracytoplasmic solute receptor protein TakP; TRAP transporter alpha-keto acid-binding subunit P; TRAP-T family sorbitol/mannitol transporter, periplasmic binding protein, SmoM from Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.) (Rhodobacter sphaeroides) (see paper)
54% identity, 100% coverage: 1:362/362 of query aligns to 1:360/365 of Q3J1R2
4yicA Crystal structure of a trap transporter solute binding protein (ipr025997) from bordetella bronchiseptica rb50 (bb0280, target efi- 500035) with bound picolinic acid
54% identity, 91% coverage: 30:357/362 of query aligns to 1:328/344 of 4yicA
7ug8B Crystal structure of a solute receptor from synechococcus cc9311 in complex with alpha-ketovaleric and calcium
51% identity, 90% coverage: 32:357/362 of query aligns to 3:328/330 of 7ug8B
5cm6A Crystal structure of a trap periplasmic solute binding protein from pseudoalteromonas atlantica t6c(patl_2292, target efi-510180) with bound sodium and pyruvate
40% identity, 88% coverage: 35:351/362 of query aligns to 4:321/331 of 5cm6A
4petA Crystal structure of a trap periplasmic solute binding protein from colwellia psychrerythraea (cps_0129, target efi-510097) with bound calcium and pyruvate (see paper)
38% identity, 89% coverage: 35:357/362 of query aligns to 5:329/329 of 4petA
Q5SK82 Lactate-binding periplasmic protein TTHA0766; ABC transporter, solute-binding protein; Extracytoplasmic solute receptor protein TTHA0766; TRAP transporter lactate-binding subunit P from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see paper)
28% identity, 94% coverage: 1:341/362 of query aligns to 4:335/361 of Q5SK82
Sites not aligning to the query:
2zzwA Crystal structure of a periplasmic substrate binding protein in complex with zinc and lactate (see paper)
28% identity, 79% coverage: 56:341/362 of query aligns to 24:304/330 of 2zzwA
2zzvA Crystal structure of a periplasmic substrate binding protein in complex with calcium and lactate (see paper)
28% identity, 79% coverage: 56:341/362 of query aligns to 24:304/330 of 2zzvA
4pe3A Crystal structure of a trap periplasmic solute binding protein from rhodobacter sphaeroides (rsph17029_3620, target efi-510199), apo open structure (see paper)
31% identity, 58% coverage: 55:264/362 of query aligns to 21:230/315 of 4pe3A
Sites not aligning to the query:
4xf5A Crystal structure of a trap periplasmic solute binding protein from chromohalobacter salexigens dsm 3043 (csal_0678), target efi-501078, with bound (s)-(+)-2-amino-1-propanol.
25% identity, 85% coverage: 32:339/362 of query aligns to 1:303/317 of 4xf5A
4uabA Crystal structure of a trap periplasmic solute binding protein from chromohalobacter salexigens dsm 3043 (csal_0678), target efi-501078, with bound ethanolamine (see paper)
24% identity, 85% coverage: 33:339/362 of query aligns to 1:302/315 of 4uabA
7e9yA Crystal structure of elacco1 (see paper)
29% identity, 44% coverage: 56:213/362 of query aligns to 24:182/563 of 7e9yA
Sites not aligning to the query:
4p8bA Crystal structure of a trap periplasmic solute binding protein from ralstonia eutropha h16 (h16_a1328), target efi-510189, with bound (s)-2-hydroxy-2-methyl-3-oxobutanoate ((s)-2-acetolactate) (see paper)
25% identity, 74% coverage: 52:319/362 of query aligns to 20:292/314 of 4p8bA
Sites not aligning to the query:
4pdhA Crystal structure of a trap periplasmic solute binding protein from polaromonas sp js666 (bpro_1871, target efi-510164) bound to d- erythronate (see paper)
24% identity, 68% coverage: 54:300/362 of query aligns to 21:265/301 of 4pdhA
Sites not aligning to the query:
4p9kA Crystal structure of a trap periplasmic solute binding protein from verminephrobacter eiseniae ef01-2 (veis_3954, target efi-510324) a nephridial symbiont of the earthworm eisenia foetida, bound to d- erythronate with residual density suggestive of superposition with copurified alternative ligand. (see paper)
25% identity, 73% coverage: 54:316/362 of query aligns to 23:280/303 of 4p9kA
Sites not aligning to the query:
Q0B2F6 Solute-binding protein Bamb_6123 from Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) (Burkholderia cepacia (strain AMMD)) (see paper)
27% identity, 65% coverage: 41:274/362 of query aligns to 38:263/328 of Q0B2F6
Sites not aligning to the query:
4pakA Crystal structure of a trap periplasmic solute binding protein from verminephrobacter eiseniae ef01-2 (veis_3954, target efi-510324) a nephridial symbiont of the earthworm eisenia foetida, bound to (r)- pantoic acid (see paper)
25% identity, 73% coverage: 54:316/362 of query aligns to 24:281/304 of 4pakA
Sites not aligning to the query:
4n17A Crystal structure of a trap periplasmic solute binding protein from burkholderia ambifaria (bam_6123), target efi-510059, with bound beta-d-galacturonate (see paper)
27% identity, 65% coverage: 41:274/362 of query aligns to 12:237/301 of 4n17A
Sites not aligning to the query:
4n15A Crystal structure of a trap periplasmic solute binding protein from burkholderia ambifaria (bam_6123), target efi-510059, with bound beta-d-glucuronate (see paper)
27% identity, 65% coverage: 41:274/362 of query aligns to 12:237/301 of 4n15A
Sites not aligning to the query:
>Dsui_1232 FitnessBrowser__PS:Dsui_1232
MDRRKFLKNAGVAAGAGVATTVAAPAIAQSQPTIKWRLTSSFPKSLDTIYGGADVLANRL
RAMTGGKFDIRVFAGGEIVPGLQALDAVQQGTVEMCHTCSYYYVGKDKTFGFGTSVPFGM
NPRQMNAWIYYGGGQKLLDEFYANYNVVSFAGGNTGTQMGGWFRKEIKTLDDVKGLKMRI
AGLGGAVFERLGAVPQQIAGSDIYPALEKGTIDAAEWVGPYDDEKLGFFKVAKNYYYPGW
WEPGPTIHFFVNKKEWDKLPKEYQEAFQAAAYEANVTMLAEYDHKNPTALSRLLSQGVKL
QKYPDAVLEAAYKAAMDLYTEESAKNPAFKKVWTEYDKYRRTQNAWFSVADTTMDRFLQS
HK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory