Comparing Dsui_2117 FitnessBrowser__PS:Dsui_2117 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 7 hits to proteins with known functional sites (download)
5mzyB Crystal structure of the decarboxylase aiba/aibb in complex with a possible transition state analog (see paper)
24% identity, 86% coverage: 35:282/288 of query aligns to 16:236/244 of 5mzyB
5mzzB Crystal structure of the decarboxylase aiba/aibb in complex with 3- methylglutaconate (see paper)
24% identity, 86% coverage: 35:282/288 of query aligns to 13:233/241 of 5mzzB
5mzxB Crystal structure of the decarboxylase aiba/aibb in complex with 4'- diphospho pantetheine (see paper)
24% identity, 86% coverage: 35:282/288 of query aligns to 13:233/241 of 5mzxB
Q29551 Succinyl-CoA:3-ketoacid coenzyme A transferase 1, mitochondrial; SCOT; 3-oxoacid CoA-transferase 1; Somatic-type succinyl-CoA:3-oxoacid CoA-transferase; SCOT-s; Succinate-coenzyme A transferase; Succinyl-CoA:3-oxoacid CoA transferase; EC 2.8.3.5 from Sus scrofa (Pig) (see 3 papers)
27% identity, 60% coverage: 18:189/288 of query aligns to 293:452/520 of Q29551
Sites not aligning to the query:
1o9lA Succinate:coenzyme-a transferase (pig heart)
26% identity, 58% coverage: 22:189/288 of query aligns to 245:400/468 of 1o9lA
Sites not aligning to the query:
3k6mC Dynamic domains of succinyl-coa:3-ketoacid-coenzyme a transferase from pig heart. (see paper)
27% identity, 58% coverage: 22:189/288 of query aligns to 245:399/466 of 3k6mC
Sites not aligning to the query:
3oxoE Succinyl-coa:3-ketoacid coa transferase from pig heart covalently bound to coa (see paper)
27% identity, 54% coverage: 34:189/288 of query aligns to 252:395/462 of 3oxoE
>Dsui_2117 FitnessBrowser__PS:Dsui_2117
MSTATATRTDSAPEAAERKGPLRYSRQEMMAIAAGREIKDGELAIFGVGLSLLAGYFAQE
HHGPNIRSMTEGGIYGATPIGGLPWGIECNRLSANATSFTGGLDALGFLVASGRVDVGLI
GAAQVDKFGNVNTTGIWSKSGDRSQGLGDTYTPPKTRLTGAGGANDIASGAKRTVIMVTH
EAKRFVDKVDYISSPGYLEGGDARARYGFVGGGPSAIVTTLGILRPHPETKEFWLDAYYP
FSSVDEVRAQTGWDLKVFRHARMIAPPTVAEVEALRRVDVTGMLRREK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory