SitesBLAST
Comparing Dsui_3281 FitnessBrowser__PS:Dsui_3281 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P0AAJ3 Formate dehydrogenase, nitrate-inducible, iron-sulfur subunit; Anaerobic formate dehydrogenase iron-sulfur subunit; Formate dehydrogenase-N subunit beta; FDH-N subunit beta from Escherichia coli (strain K12) (see paper)
69% identity, 99% coverage: 1:292/296 of query aligns to 1:291/294 of P0AAJ3
- C39 (= C36) binding
- C42 (= C39) binding
- C45 (= C42) binding
- C49 (= C46) binding
- C100 (= C101) binding
- C103 (= C104) binding
- C108 (= C109) binding
- C112 (= C113) binding
- C133 (= C134) binding
- C136 (= C137) binding
- C139 (= C140) binding
- C143 (= C144) binding
- C160 (= C161) binding
- C163 (= C164) binding
- C175 (= C176) binding
- C179 (= C180) binding
1kqfB Formate dehydrogenase n from e. Coli (see paper)
69% identity, 98% coverage: 2:290/296 of query aligns to 1:288/289 of 1kqfB
- binding protoporphyrin ix containing fe: Y137 (= Y139), W252 (= W254)
- binding iron/sulfur cluster: K31 (= K29), C38 (= C36), I39 (= I37), G40 (= G38), C41 (= C39), K42 (= K40), C44 (= C42), C48 (= C46), N52 (= N50), T77 (= T75), M79 (= M77), C99 (= C101), M100 (= M102), H101 (= H103), C102 (= C104), P105 (= P107), C107 (= C109), C111 (= C113), P112 (= P114), I117 (= I119), V125 (= V127), C132 (= C134), I133 (= I135), G134 (= G136), C135 (= C137), G136 (= G138), Y137 (= Y139), C138 (= C140), C142 (= C144), I146 (≠ V148), P147 (= P149), V156 (≠ A158), K158 (= K160), C159 (= C161), L161 (= L163), C162 (= C164), P172 (= P174), C174 (= C176), C178 (= C180), P179 (= P181), I183 (= I185)
8cm6D W-formate dehydrogenase c872a from desulfovibrio vulgaris - with formamide (see paper)
35% identity, 71% coverage: 30:240/296 of query aligns to 5:211/214 of 8cm6D
- binding formamide: R59 (≠ Q84), P62 (≠ G90)
- binding iron/sulfur cluster: C11 (= C36), T12 (≠ I37), A13 (≠ G38), C14 (= C39), R15 (≠ K40), C17 (= C42), C21 (= C46), K25 (≠ N50), K50 (≠ T75), C73 (= C101), R74 (≠ M102), C76 (= C104), P79 (= P107), P80 (≠ G108), C81 (= C109), V102 (= V127), C120 (= C144), I124 (≠ V148), P125 (= P149), K136 (= K160), C137 (= C161), D138 (≠ N162), M139 (≠ L163), C140 (= C164), C152 (= C176), C156 (= C180), P157 (= P181), T158 (= T182), T160 (≠ A184), M161 (≠ I185)
Sites not aligning to the query:
8bqgB W-formate dehydrogenase from desulfovibrio vulgaris - soaking with formate 1 min (see paper)
35% identity, 71% coverage: 30:240/296 of query aligns to 5:211/214 of 8bqgB
- binding iron/sulfur cluster: C11 (= C36), T12 (≠ I37), A13 (≠ G38), C14 (= C39), R15 (≠ K40), C17 (= C42), C21 (= C46), K25 (≠ N50), K50 (≠ T75), C73 (= C101), R74 (≠ M102), C76 (= C104), P80 (≠ G108), C81 (= C109), V102 (= V127), C120 (= C144), I124 (≠ V148), P125 (= P149), K136 (= K160), C137 (= C161), M139 (≠ L163), C140 (= C164), C152 (= C176), C156 (= C180), P157 (= P181), T158 (= T182), T160 (≠ A184), M161 (≠ I185)
Sites not aligning to the query:
1h0hB Tungsten containing formate dehydrogenase from desulfovibrio gigas (see paper)
30% identity, 71% coverage: 30:239/296 of query aligns to 5:209/214 of 1h0hB
- binding iron/sulfur cluster: C11 (= C36), T12 (≠ I37), A13 (≠ G38), C14 (= C39), R15 (≠ K40), C17 (= C42), C21 (= C46), H25 (≠ N50), K50 (≠ T75), Q71 (≠ G100), C72 (= C101), R73 (≠ M102), C75 (= C104), P79 (≠ G108), C80 (= C109), V101 (vs. gap), C120 (= C144), P125 (= P149), K136 (= K160), C137 (= C161), D138 (≠ N162), M139 (≠ L163), C140 (= C164), C152 (= C176), C156 (= C180), P157 (= P181), A160 (= A184)
Sites not aligning to the query:
Q8GC87 Formate dehydrogenase subunit beta; FDH subunit beta; Formate dehydrogenase small subunit from Megalodesulfovibrio gigas (strain ATCC 19364 / DSM 1382 / NCIMB 9332 / VKM B-1759) (Desulfovibrio gigas) (see paper)
30% identity, 71% coverage: 30:239/296 of query aligns to 6:210/215 of Q8GC87
- C12 (= C36) binding
- C15 (= C39) binding
- C18 (= C42) binding
- C22 (= C46) binding
- C73 (= C101) binding
- C76 (= C104) binding
- C81 (= C109) binding
- C121 (= C144) binding
- C138 (= C161) binding
- C141 (= C164) binding
- C153 (= C176) binding
- C157 (= C180) binding
P18776 Anaerobic dimethyl sulfoxide reductase chain B; DMSO reductase iron-sulfur subunit from Escherichia coli (strain K12) (see 2 papers)
34% identity, 56% coverage: 30:195/296 of query aligns to 8:160/205 of P18776
- C102 (= C137) mutation C->F,S,W,Y: Loss of electron transfer from menaquinol to DMSO.
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
2vpyF Polysulfide reductase with bound quinone inhibitor, pentachlorophenol (pcp) (see paper)
37% identity, 58% coverage: 28:199/296 of query aligns to 5:154/193 of 2vpyF
- binding pentachlorophenol: I91 (= I135), C93 (= C137)
- binding iron/sulfur cluster: C13 (= C36), G15 (= G38), C16 (= C39), C19 (= C42), C23 (= C46), N27 (= N50), L36 (≠ A73), I38 (≠ M77), P55 (≠ K98), Q57 (≠ G100), C58 (= C101), L59 (≠ M102), C61 (= C104), P65 (≠ G108), C66 (= C109), C70 (= C113), P71 (= P114), V83 (= V127), C90 (= C134), I91 (= I135), A92 (≠ G136), C93 (= C137), G94 (= G138), C96 (= C140), C100 (= C144), P101 (= P145), Y102 (≠ F146), R105 (≠ P149), V113 (≠ K157), C116 (= C161), F118 (≠ L163), C119 (= C164), P129 (= P174), A130 (= A175), C131 (= C176), C135 (= C180), C139 (≠ A184), R140 (≠ I185)
Sites not aligning to the query:
2vpwF Polysulfide reductase with bound menaquinone (see paper)
37% identity, 58% coverage: 28:199/296 of query aligns to 5:154/193 of 2vpwF
- binding iron/sulfur cluster: C13 (= C36), G15 (= G38), C16 (= C39), C19 (= C42), C23 (= C46), N27 (= N50), L36 (≠ A73), I38 (≠ M77), P55 (≠ K98), Q57 (≠ G100), C58 (= C101), L59 (≠ M102), H60 (= H103), C61 (= C104), P65 (≠ G108), C66 (= C109), C70 (= C113), P71 (= P114), V83 (= V127), C90 (= C134), I91 (= I135), A92 (≠ G136), C93 (= C137), G94 (= G138), C96 (= C140), C100 (= C144), P101 (= P145), Y102 (≠ F146), R105 (≠ P149), V113 (≠ K157), C116 (= C161), F118 (≠ L163), C119 (= C164), P129 (= P174), A130 (= A175), C131 (= C176), C135 (= C180), C139 (≠ A184), R140 (≠ I185)
Sites not aligning to the query:
5ch7B Crystal structure of the perchlorate reductase pcrab - phe164 gate switch intermediate - from azospira suillum ps (see paper)
39% identity, 35% coverage: 101:205/296 of query aligns to 133:237/329 of 5ch7B
- binding fe3-s4 cluster: C145 (= C113), I150 (≠ A118), C166 (= C134), K167 (≠ I135), G168 (= G136), A169 (≠ C137), Q170 (≠ G138), A171 (≠ Y139), C172 (= C140), A190 (= A158)
- binding iron/sulfur cluster: C133 (= C101), N134 (≠ M102), C136 (= C104), P139 (= P107), C141 (= C109), C176 (= C144), C193 (= C161), G195 (≠ L163), C196 (= C164), C208 (= C176), C212 (= C180), V213 (≠ P181), G214 (≠ T182)
Sites not aligning to the query:
- binding iron/sulfur cluster: 17, 18, 19, 20, 21, 23, 27, 31, 43, 45, 130
2ivfB Ethylbenzene dehydrogenase from aromatoleum aromaticum (see paper)
34% identity, 49% coverage: 62:205/296 of query aligns to 96:240/337 of 2ivfB
- binding fe3-s4 cluster: C148 (= C113), T150 (≠ S115), I153 (≠ A118), C169 (= C134), K170 (≠ I135), G171 (= G136), H172 (≠ C137), R173 (≠ G138), H174 (≠ Y139), C175 (= C140), S193 (≠ A158)
- binding protoporphyrin ix containing fe: T150 (≠ S115), K170 (≠ I135), H172 (≠ C137)
- binding iron/sulfur cluster: M135 (≠ K98), C136 (= C101), N137 (≠ M102), H138 (= H103), C139 (= C104), P142 (= P107), C144 (= C109), V162 (= V127), C179 (= C144), A183 (≠ V148), I184 (≠ P149), K195 (= K160), C196 (= C161), I197 (≠ N162), L198 (= L163), C199 (= C164), N209 (≠ P174), C211 (= C176), C215 (= C180), V219 (≠ A184), R220 (≠ I185)
Sites not aligning to the query:
- binding iron/sulfur cluster: 13, 14, 15, 16, 17, 19, 23, 27, 38, 39, 41
7qv7B Cryo-em structure of hydrogen-dependent co2 reductase. (see paper)
32% identity, 60% coverage: 23:199/296 of query aligns to 4:173/183 of 7qv7B
- binding iron/sulfur cluster: C14 (= C36), G16 (= G38), C17 (= C39), K18 (= K40), A19 (= A41), C20 (= C42), C24 (= C46), H28 (≠ N50), R48 (≠ D86), C63 (= C101), R64 (≠ M102), H65 (= H103), C66 (= C104), A69 (≠ P107), C71 (= C109), C75 (= C113), A79 (= A118), I80 (= I119), C94 (= C134), I95 (= I135), C97 (= C137), C100 (= C140), C104 (= C144), I109 (≠ P149), C139 (= C161), L141 (= L163), C142 (= C164), P148 (= P174), C150 (= C176), C154 (= C180), P155 (= P181), L159 (≠ I185)
3egwB The crystal structure of the narghi mutant narh - c16a
37% identity, 29% coverage: 101:187/296 of query aligns to 184:269/509 of 3egwB
- binding fe3-s4 cluster: C196 (= C113), S198 (= S115), I201 (≠ A118), C217 (= C134), R218 (≠ I135), G219 (= G136), W220 (≠ C137), R221 (≠ G138), C223 (= C140), S241 (≠ A158), C263 (= C180), G265 (= G183), R268 (≠ Q186)
- binding protoporphyrin ix containing fe: W220 (≠ C137), R221 (≠ G138)
- binding iron/sulfur cluster: C184 (= C101), E185 (≠ M102), H186 (= H103), C187 (= C104), P190 (= P107), C192 (= C109), C227 (= C144), I232 (≠ P149), K243 (= K160), C244 (= C161), F246 (≠ L163), C247 (= C164), T257 (≠ P174), C259 (= C176)
Sites not aligning to the query:
P11349 Respiratory nitrate reductase 1 beta chain; Nitrate reductase A subunit beta; Quinol-nitrate oxidoreductase subunit beta; EC 1.7.5.1 from Escherichia coli (strain K12) (see 2 papers)
37% identity, 29% coverage: 101:187/296 of query aligns to 184:269/512 of P11349
- C184 (= C101) binding
- C187 (= C104) binding
- C192 (= C109) binding
- C196 (= C113) binding
- C217 (= C134) binding
- C223 (= C140) binding
- C227 (= C144) binding
- C244 (= C161) binding
- C247 (= C164) binding
- C259 (= C176) binding
- C263 (= C180) binding
Sites not aligning to the query:
- 16 binding
- 19 binding
- 22 binding
- 26 binding
6cz7B The arsenate respiratory reductase (arr) complex from shewanella sp. Ana-3 (see paper)
24% identity, 60% coverage: 25:201/296 of query aligns to 1:204/234 of 6cz7B
- binding iron/sulfur cluster: C12 (= C36), V13 (≠ I37), G14 (= G38), C15 (= C39), G16 (≠ K40), C18 (= C42), C22 (= C46), N26 (= N50), Y52 (≠ K91), P54 (≠ E93), C57 (= C101), N58 (≠ M102), H59 (= H103), C60 (= C104), A63 (≠ P107), P64 (≠ G108), C65 (= C109), C69 (= C113), P70 (= P114), T82 (≠ V127), C89 (= C134), I90 (= I135), G91 (= G136), C92 (= C137), K93 (≠ G138), C95 (= C140), C99 (= C144), Y101 (≠ F146), V103 (= V148), I104 (vs. gap), T161 (vs. gap), K163 (= K160), C164 (= C161), F166 (≠ L163), C167 (= C164), C179 (= C176), C183 (= C180), P184 (= P181), R188 (≠ I185)
Q7WTT9 Arsenate respiratory reductase iron-sulfur subunit ArrB; Arsenate respiratory reductase small subunit; ARR small subunit from Shewanella sp. (strain ANA-3) (see paper)
24% identity, 60% coverage: 25:201/296 of query aligns to 1:204/234 of Q7WTT9
- C12 (= C36) binding
- C15 (= C39) binding
- C18 (= C42) binding
- C22 (= C46) binding
- C57 (= C101) binding
- C60 (= C104) binding
- C65 (= C109) binding
- C69 (= C113) binding
- C89 (= C134) binding
- C92 (= C137) binding
- C95 (= C140) binding
- C99 (= C144) binding
- C164 (= C161) binding
- C167 (= C164) binding
- C179 (= C176) binding
- C183 (= C180) binding
8c0zC Cryoem structure of a tungsten-containing aldehyde oxidoreductase from aromatoleum aromaticum (see paper)
29% identity, 58% coverage: 31:202/296 of query aligns to 7:153/158 of 8c0zC
- binding iron/sulfur cluster: C12 (= C36), T13 (≠ I37), C15 (= C39), C18 (= C42), C22 (= C46), C53 (= C101), C56 (= C104), C61 (= C109), C65 (= C113), I70 (≠ A118), C86 (= C134), C89 (= C137), C92 (= C140), C96 (= C144), T100 (≠ V148), K112 (= K160), C113 (= C161), C116 (= C164), C122 (= C176), C126 (= C180), T128 (= T182)
6f0kB Alternative complex iii (see paper)
25% identity, 58% coverage: 28:200/296 of query aligns to 725:926/961 of 6f0kB
- binding fe3-s4 cluster: C803 (= C113), V805 (≠ S115), M818 (≠ F129), C823 (= C134), I824 (= I135), G825 (= G136), C829 (= C140), M869 (vs. gap)
- binding heme c: N821 (≠ E132), R822 (≠ N133), R884 (vs. gap), N887 (vs. gap)
- binding iron/sulfur cluster: C733 (= C36), T734 (≠ I37), G735 (= G38), C736 (= C39), N737 (≠ K40), A738 (= A41), C739 (= C42), C743 (= C46), W765 (≠ D68), I768 (≠ A71), C791 (= C101), M792 (= M102), H793 (= H103), C794 (= C104), P798 (≠ G108), C799 (= C109), N816 (≠ V127), C833 (= C144), C872 (= C161), Y874 (≠ L163), C875 (= C164), A901 (= A175), C902 (= C176), C906 (= C180)
Sites not aligning to the query:
6x6uB Wor5 from pyrococcus furiosus, taurine-bound (see paper)
39% identity, 27% coverage: 101:180/296 of query aligns to 52:125/167 of 6x6uB
- binding iron/sulfur cluster: C52 (= C101), V53 (≠ M102), C55 (= C104), P59 (≠ G108), C60 (= C109), C64 (= C113), P65 (= P114), L69 (≠ A118), C85 (= C134), I86 (= I135), T87 (≠ G136), C88 (= C137), G89 (= G138), C91 (= C140), C95 (= C144), P100 (= P149), C112 (= C161), D113 (≠ N162), L114 (= L163), C115 (= C164), P119 (= P174), C121 (= C176), C125 (= C180)
Sites not aligning to the query:
- binding phosphate ion: 10, 128, 130, 161, 162
- binding iron/sulfur cluster: 12, 13, 15, 16, 18, 22, 26, 36, 37, 39, 130, 133
7b04A of Nitrite oxidoreductase (Nxr) from the anammox bacterium Kuenenia stuttgartiensis.
37% identity, 23% coverage: 101:168/296 of query aligns to 174:241/409 of 7b04A
- binding fe3-s4 cluster: C186 (= C113), I191 (≠ A118), C207 (= C134), R208 (≠ I135), G209 (= G136), Y210 (≠ C137), R211 (≠ G138), K212 (≠ Y139), C213 (= C140), S231 (≠ A158)
- binding protoporphyrin ix containing fe: R188 (≠ S115), R208 (≠ I135), Y210 (≠ C137)
- binding iron/sulfur cluster: C174 (= C101), N175 (≠ M102), H176 (= H103), C177 (= C104), P180 (= P107), C182 (= C109), C217 (= C144), P222 (= P149), K233 (= K160), C234 (= C161), A236 (≠ L163), C237 (= C164)
Sites not aligning to the query:
- binding iron/sulfur cluster: 34, 35, 36, 37, 38, 40, 44, 48, 59, 60, 62, 171, 173, 255, 256, 257, 261, 262, 265, 266
Query Sequence
>Dsui_3281 FitnessBrowser__PS:Dsui_3281
MALQSLDILRRSASPTAAPQARNPLEVAKLIDVSVCIGCKACQVACSEWNELRDDVGSCV
GVYDNPTDLSAQAWTVMRFNEVEQPDVSGGKLEWLIRKDGCMHCADPGCLKACPSPGAII
QYKNGIVDFHQENCIGCGYCVSGCPFNVPRINPKDNKAYKCNLCSDRVAVGQEPACVKTC
PTGAIQFGSKEDMQEVAAKRVTDLKSRGYDNAGLYDPQGVGGTHVMYVLHHADKPELYNN
LPKDPAISTTVSLWKGLLKPVATLGIAAAGLFGFFHYITVGPNRAEDEHEAEEVTK
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory