SitesBLAST
Comparing Dsui_3451 FitnessBrowser__PS:Dsui_3451 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 4 hits to proteins with known functional sites (download)
Q9NRA2 Sialin; H(+)/nitrate cotransporter; H(+)/sialic acid cotransporter; AST; Membrane glycoprotein HP59; Solute carrier family 17 member 5; Vesicular excitatory amino acid transporter; VEAT from Homo sapiens (Human) (see 8 papers)
24% identity, 59% coverage: 35:285/427 of query aligns to 88:355/495 of Q9NRA2
- K136 (≠ R82) to E: in SD; alters intracellular localization, only partially targeted to lysosomes and mainly detected in LAMP1-negative vesicles and in the Golgi apparatus; completely devoid of L-aspartate and L-glutamate transporter activity, but retains appreciable H(+)-coupled sialic acid transporter activity; dbSNP:rs80338795
- H183 (≠ L127) to R: in ISSD; alters intracellular localization, only partially targeted to lysosomes and mainly detected in LAMP1-negative vesicles and in the Golgi apparatus; abolishes H(+)-coupled sialic acid transporter activity; has normal L-aspartate and L-glutamate transporter activity; dbSNP:rs119491109
- LL 198:199 (≠ LV 142:143) mutation to AA: Localizes in vesicular structures mainly concentrated in the perinuclear region.
- IL 266:267 (≠ IF 207:208) mutation to LA: Localizes in vesicular structures mainly concentrated in the perinuclear region.
- SSLRN 268:272 (≠ GGLAS 209:213) natural variant: Missing (in ISSD; alters intracellular localization, only partially targeted to lysosomes and mainly detected in LAMP1-negative vesicles and in the Golgi apparatus; abolishes H(+)-coupled sialic acid transporter activity; has normal L-aspartate and L-glutamate transporter activity)
- G328 (≠ S258) to E: in ISSD; some patients may manifest a milder phenotype consistent with Salla disease; markedly decreases H(+)-coupled sialic acid transporter activity; abolishes L-aspartate and L-glutamate transporter activity; dbSNP:rs386833996
- P334 (≠ Y264) to R: in ISSD; does not affect intracellular localization, targeted to lysosomes; abolishes H(+)-coupled sialic acid transporter activity; abolishes L-aspartate and L-glutamate transporter activity; dbSNP:rs119491110
Sites not aligning to the query:
- 22:23 Dileucine internalization motif; LL→AA: Targeted to plasma membrane.; LL→GG: Targeted to plasma membrane; sialic acid uptake strongly activated at acidic pH.
- 39 R → C: in SD; frequent variant in Finland; alters intracellular localization, only partially targeted to lysosomes and mainly detected in LAMP1-negative vesicles and in the Golgi apparatus; completely devoid of L-aspartate and L-glutamate transport activity, but retains appreciable H(+)-coupled sialic acid and nitrate transporter activity; dbSNP:rs80338794
- 371 G → V: in ISSD; abolishes H(+)-coupled sialic acid transporter activity; abolishes L-aspartate and L-glutamate transporter activity; dbSNP:rs777862172
P0AA76 D-galactonate transporter; D-galactonate/H(+) symporter from Escherichia coli (strain K12) (see paper)
20% identity, 83% coverage: 15:368/427 of query aligns to 14:394/430 of P0AA76
- Y29 (≠ F30) binding
- D31 (≠ H32) mutation to N: Loss of galactonate transport activity.
- R32 (= R33) binding
- Y64 (= Y65) binding
- E118 (≠ V119) mutation to Q: Loss of galactonate transport activity.
- W358 (= W332) binding
6e9nA E. Coli d-galactonate:proton symporter in the inward open form (see paper)
20% identity, 83% coverage: 15:368/427 of query aligns to 3:375/409 of 6e9nA
6e9oA E. Coli d-galactonate:proton symporter mutant e133q in the outward substrate-bound form (see paper)
20% identity, 83% coverage: 15:368/427 of query aligns to 6:359/393 of 6e9oA
Query Sequence
>Dsui_3451 FitnessBrowser__PS:Dsui_3451
MPPHQSGGSSARTARAVTLAVVIAAYMLSFFHRFAPAGIAHDLTLAFQTTAASLGALAAT
YFYVYTIMQVPTGVLVDTLGPRRILFLGGLVAAAGSVLFGLADTLNEALVGRTLVGLGVS
VTFIAMLKIIAVNFDERRFATLVGASMLVGNLGSVLAGAPLSLLAQSISWRGIFVGAGAL
SALLGVACWFFVKDGGGERPRFDRTVIFGGLASVLKNRSTWPAVVVNFGLAGSFFSFAGL
WATPYLMRVHELTRAQASSHLSLYFAGFALGCFFIGTLSDRLGKRKPVVIAGAFLYCLLW
LFWLTNIRLPLAATYCLFGLMGLTTASFALTWACAKEVNPPMLSGMSTSVTNMGGFLAGA
LLQPLAGWAMDQVWDGTLANGVRVYGPDTFRVGMACMAAAACIGFVACFWVKETGCRNIW
QAPRPGP
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory