SitesBLAST
Comparing EX31_RS25170 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
8rd8Ba Small ribosomal subunit protein uS5 (see paper)
84% identity, 96% coverage: 1:44/46 of query aligns to 1:44/44 of 8rd8Ba
- binding : M1 (= M1), K2 (= K2), R3 (= R3), T4 (= T4), F5 (= F5), Q6 (= Q6), P7 (= P7), S8 (= S8), V9 (= V9), I10 (≠ L10), K11 (= K11), R12 (= R12), K13 (≠ N13), R14 (= R14), H16 (= H16), F18 (= F18), R19 (= R19), R21 (= R21), M22 (= M22), K25 (= K25), K26 (≠ N26), Q29 (= Q29), A32 (= A32), R33 (= R33), R34 (= R34), R35 (= R35), K37 (= K37), G38 (= G38), R39 (= R39), H40 (≠ T40), R41 (= R41)
8cd14 phikz014 (see paper)
84% identity, 96% coverage: 1:44/46 of query aligns to 1:44/44 of 8cd14
- binding : M1 (= M1), K2 (= K2), R3 (= R3), T4 (= T4), F5 (= F5), Q6 (= Q6), S8 (= S8), T9 (≠ V9), L10 (= L10), K11 (= K11), R12 (= R12), A13 (≠ N13), R14 (= R14), V15 (≠ S15), H16 (= H16), F18 (= F18), R19 (= R19), R21 (= R21), M22 (= M22), N26 (= N26), V30 (= V30), R33 (= R33), R34 (= R34), R35 (= R35), K37 (= K37), G38 (= G38), R39 (= R39), K40 (≠ T40), R41 (= R41), T43 (≠ S43), V44 (≠ A44)
7unw6 50S ribosomal protein L34
84% identity, 96% coverage: 1:44/46 of query aligns to 1:44/44 of 7unw6
- binding magnesium ion: S32 (≠ A32), R35 (= R35)
- binding : M1 (= M1), R3 (= R3), T4 (= T4), F5 (= F5), Q6 (= Q6), S8 (= S8), T9 (≠ V9), L10 (= L10), K11 (= K11), R12 (= R12), A13 (≠ N13), R14 (= R14), H16 (= H16), F18 (= F18), R19 (= R19), R21 (= R21), K25 (= K25), N26 (= N26), R33 (= R33), R34 (= R34), R35 (= R35), K37 (= K37), G38 (= G38), R39 (= R39), K40 (≠ T40), R41 (= R41)
7m4v1 A. Baumannii ribosome-eravacycline complex: 50s (see paper)
82% identity, 96% coverage: 1:44/46 of query aligns to 1:44/44 of 7m4v1
- binding : M1 (= M1), K2 (= K2), R3 (= R3), T4 (= T4), F5 (= F5), Q6 (= Q6), S8 (= S8), E9 (≠ V9), K11 (= K11), R12 (= R12), K13 (≠ N13), R14 (= R14), H16 (= H16), F18 (= F18), R19 (= R19), R21 (= R21), K25 (= K25), A26 (≠ N26), Q29 (= Q29), R33 (= R33), R34 (= R34), R35 (= R35), K37 (= K37), G38 (= G38), R39 (= R39), H40 (≠ T40)
8a3l1 50S ribosomal protein L36 (see paper)
93% identity, 100% coverage: 1:46/46 of query aligns to 1:46/46 of 8a3l1
- binding : M1 (= M1), K2 (= K2), R3 (= R3), T4 (= T4), F5 (= F5), Q6 (= Q6), P7 (= P7), S8 (= S8), V9 (= V9), L10 (= L10), K11 (= K11), R12 (= R12), N13 (= N13), R14 (= R14), H16 (= H16), F18 (= F18), R19 (= R19), R21 (= R21), K25 (= K25), N26 (= N26), R33 (= R33), R34 (= R34), R35 (= R35), K37 (= K37), G38 (= G38), R39 (= R39), A40 (≠ T40), R41 (= R41), S45 (= S45), K46 (= K46)
3bbx2 The hsp15 protein fitted into the low resolution cryo-em map of the 50s.Nc-tRNA.Hsp15 complex (see paper)
93% identity, 100% coverage: 1:46/46 of query aligns to 1:46/46 of 3bbx2
- binding magnesium ion: R3 (= R3), F5 (= F5)
- binding : M1 (= M1), K2 (= K2), R3 (= R3), T4 (= T4), F5 (= F5), Q6 (= Q6), S8 (= S8), V9 (= V9), L10 (= L10), K11 (= K11), R12 (= R12), S15 (= S15), H16 (= H16), G17 (= G17), R19 (= R19), R21 (= R21), T24 (= T24), N26 (= N26), G27 (= G27), V30 (= V30), R34 (= R34), G38 (= G38), R39 (= R39), A40 (≠ T40), R41 (= R41), L42 (= L42), T43 (≠ S43), V44 (≠ A44)
7a0r2 50s deinococcus radiodurans ribosome bounded with mycinamicin i (see paper)
67% identity, 98% coverage: 1:45/46 of query aligns to 1:45/47 of 7a0r2
- binding : M1 (= M1), K2 (= K2), R3 (= R3), T4 (= T4), Y5 (≠ F5), Q6 (= Q6), P7 (= P7), N8 (≠ S8), N9 (≠ V9), R10 (≠ L10), K11 (= K11), R12 (= R12), A13 (≠ N13), K14 (≠ R14), H16 (= H16), G17 (= G17), F18 (= F18), R19 (= R19), R21 (= R21), M22 (= M22), S26 (≠ N26), I30 (≠ V30), R33 (= R33), R35 (= R35), K37 (= K37), G38 (= G38), R39 (= R39), H40 (≠ T40), L42 (= L42), S45 (= S45)
Sites not aligning to the query:
3j3v2 Atomic model of the immature 50s subunit from bacillus subtilis (state i-a) (see paper)
70% identity, 96% coverage: 1:44/46 of query aligns to 1:44/44 of 3j3v2
- binding : M1 (= M1), K2 (= K2), R3 (= R3), T4 (= T4), F5 (= F5), Q6 (= Q6), N8 (≠ S8), N9 (≠ V9), R10 (≠ L10), K11 (= K11), R12 (= R12), K14 (≠ R14), V15 (≠ S15), H16 (= H16), G17 (= G17), F18 (= F18), R19 (= R19), S20 (≠ A20), M22 (= M22), K25 (= K25), R28 (= R28), R33 (= R33), R34 (= R34), R35 (= R35), R36 (≠ A36), K37 (= K37), G38 (= G38), R39 (= R39), K40 (≠ T40), V41 (≠ R41), A44 (= A44)
8uua6 Cryo-em structure of the listeria innocua 50s ribosomal subunit in complex with hflxr (structure iii) (see paper)
70% identity, 93% coverage: 1:43/46 of query aligns to 1:43/43 of 8uua6
- binding magnesium ion: K25 (= K25), N26 (= N26)
- binding : M1 (= M1), R3 (= R3), T4 (= T4), Y5 (≠ F5), Q6 (= Q6), P7 (= P7), S8 (= S8), K9 (≠ V9), R10 (≠ L10), K11 (= K11), R12 (= R12), K13 (≠ N13), K14 (≠ R14), H16 (= H16), F18 (= F18), R19 (= R19), R21 (= R21), K25 (= K25), N26 (= N26), R29 (≠ Q29), R34 (= R34), R35 (= R35), K37 (= K37), G38 (= G38), R39 (= R39)
6dddP Structure of the 50s ribosomal subunit from methicillin resistant staphylococcus aureus in complex with the oxazolidinone antibiotic lzd-5 (see paper)
66% identity, 96% coverage: 1:44/46 of query aligns to 1:44/44 of 6dddP
- binding : V1 (≠ M1), R3 (= R3), T4 (= T4), Y5 (≠ F5), Q6 (= Q6), P7 (= P7), N8 (≠ S8), K9 (≠ V9), R10 (≠ L10), K11 (= K11), H12 (≠ R12), S13 (≠ N13), H16 (= H16), F18 (= F18), R19 (= R19), R21 (= R21), K25 (= K25), N26 (= N26), K29 (≠ Q29), R33 (= R33), R34 (= R34), R36 (≠ A36), K37 (= K37), G38 (= G38), R39 (= R39), K40 (≠ T40)
6o8w4 30S ribosomal protein S10 (see paper)
66% identity, 96% coverage: 1:44/46 of query aligns to 1:44/44 of 6o8w4
- binding : M1 (= M1), R3 (= R3), T4 (= T4), Y5 (≠ F5), Q6 (= Q6), P7 (= P7), N8 (≠ S8), K9 (≠ V9), R10 (≠ L10), K11 (= K11), R12 (= R12), Q13 (≠ N13), K14 (≠ R14), H16 (= H16), F18 (= F18), R19 (= R19), R21 (= R21), K25 (= K25), N26 (= N26), R29 (≠ Q29), R34 (= R34), R35 (= R35), R36 (≠ A36), K37 (= K37), R39 (= R39)
9c4g1 Cutibacterium acnes 50s ribosomal subunit with clindamycin bound (see paper)
66% identity, 96% coverage: 1:44/46 of query aligns to 1:44/44 of 9c4g1
- binding : M1 (= M1), K2 (= K2), R3 (= R3), T4 (= T4), F5 (= F5), Q6 (= Q6), P7 (= P7), S8 (= S8), N9 (≠ V9), R10 (≠ L10), R11 (≠ K11), R12 (= R12), A13 (≠ N13), R14 (= R14), N15 (≠ S15), H16 (= H16), G17 (= G17), F18 (= F18), R19 (= R19), R21 (= R21), R25 (≠ K25), A26 (≠ N26), R34 (= R34), R35 (= R35), R36 (≠ A36), K37 (= K37), G38 (= G38), R39 (= R39), V40 (≠ T40)
8crx1 30S ribosomal protein S17 (see paper)
66% identity, 96% coverage: 1:44/46 of query aligns to 1:44/44 of 8crx1
- binding magnesium ion: T4 (= T4), F5 (= F5)
- binding : M1 (= M1), K2 (= K2), R3 (= R3), T4 (= T4), F5 (= F5), Q6 (= Q6), P7 (= P7), S8 (= S8), N9 (≠ V9), R10 (≠ L10), R11 (≠ K11), R12 (= R12), A13 (≠ N13), R14 (= R14), N15 (≠ S15), H16 (= H16), G17 (= G17), F18 (= F18), R19 (= R19), R21 (= R21), R25 (≠ K25), A26 (≠ N26), R34 (= R34), R35 (= R35), R36 (≠ A36), K37 (= K37), G38 (= G38), R39 (= R39), V40 (≠ T40)
8p7x0 50S ribosomal protein L29 (see paper)
62% identity, 98% coverage: 1:45/46 of query aligns to 1:45/48 of 8p7x0
- binding : M1 (= M1), K2 (= K2), R3 (= R3), T4 (= T4), Y5 (≠ F5), Q6 (= Q6), P7 (= P7), S8 (= S8), K9 (≠ V9), K11 (= K11), R12 (= R12), T15 (≠ S15), H16 (= H16), G17 (= G17), F18 (= F18), L19 (≠ R19), R21 (= R21), S26 (≠ N26), K32 (≠ A32), R34 (= R34), R35 (= R35), K36 (≠ A36), K37 (= K37), Q38 (≠ G38), R39 (= R39), A40 (≠ T40), S45 (= S45)
Sites not aligning to the query:
5a9zAd of Thermous thermophilus ribosome bound to BipA-GDPCP (see paper)
62% identity, 98% coverage: 1:45/46 of query aligns to 1:45/49 of 5a9zAd
- binding : M1 (= M1), K2 (= K2), R3 (= R3), T4 (= T4), W5 (≠ F5), Q6 (= Q6), P7 (= P7), N8 (≠ S8), R9 (≠ V9), R10 (≠ L10), K11 (= K11), R12 (= R12), A13 (≠ N13), K14 (≠ R14), H16 (= H16), G17 (= G17), F18 (= F18), R19 (= R19), M22 (= M22), R23 (≠ A23), R28 (= R28), K29 (≠ Q29), V30 (= V30), K32 (≠ A32), R33 (= R33), R34 (= R34), G38 (= G38), R39 (= R39), W40 (≠ T40)
Sites not aligning to the query:
1vy4B7 50S ribosomal protein L36 (see paper)
62% identity, 98% coverage: 1:45/46 of query aligns to 1:45/48 of 1vy4B7
- binding magnesium ion: K2 (= K2), R3 (= R3), N8 (≠ S8), R10 (≠ L10), A13 (≠ N13), K14 (≠ R14), G17 (= G17), R19 (= R19), A20 (= A20)
- binding : M1 (= M1), K2 (= K2), R3 (= R3), T4 (= T4), W5 (≠ F5), Q6 (= Q6), P7 (= P7), N8 (≠ S8), R9 (≠ V9), R10 (≠ L10), K11 (= K11), R12 (= R12), A13 (≠ N13), K14 (≠ R14), H16 (= H16), G17 (= G17), F18 (= F18), R19 (= R19), R21 (= R21), M22 (= M22), P25 (≠ K25), G26 (≠ N26), K29 (≠ Q29), K32 (≠ A32), R33 (= R33), R34 (= R34), R35 (= R35), Q36 (≠ A36), K37 (= K37), G38 (= G38), R39 (= R39), W40 (≠ T40), R41 (= R41)
Sites not aligning to the query:
5myjB6 of 70S ribosome from Lactococcus lactis (see paper)
64% identity, 96% coverage: 1:44/46 of query aligns to 1:44/44 of 5myjB6
- binding : M1 (= M1), R3 (= R3), T4 (= T4), Y5 (≠ F5), Q6 (= Q6), P7 (= P7), H8 (≠ S8), K9 (≠ V9), K10 (≠ L10), S11 (≠ K11), R12 (= R12), K13 (≠ N13), H16 (= H16), G17 (= G17), F18 (= F18), R19 (= R19), R21 (= R21), K25 (= K25), N26 (= N26), R28 (= R28), R29 (≠ Q29), V30 (= V30), R34 (= R34), R35 (= R35), R36 (≠ A36), K37 (= K37), R39 (= R39), A40 (≠ T40)
8c972 Cryo-em captures early ribosome assembly in action (see paper)
100% identity, 59% coverage: 10:36/46 of query aligns to 1:27/32 of 8c972
Sites not aligning to the query:
5o60d Structure of the 50s large ribosomal subunit from mycobacterium smegmatis (see paper)
58% identity, 93% coverage: 2:44/46 of query aligns to 4:46/46 of 5o60d
- binding : R5 (= R3), T6 (= T4), F7 (= F5), Q8 (= Q6), P9 (= P7), N10 (≠ S8), N11 (≠ V9), R12 (≠ L10), R13 (≠ K11), R14 (= R12), A15 (≠ N13), R16 (= R14), H18 (= H16), G19 (= G17), F20 (= F18), R21 (= R19), R23 (= R21), R27 (≠ K25), I32 (≠ V30), R36 (= R34), R37 (= R35), K39 (= K37), G40 (= G38), R41 (= R39), R42 (≠ T40)
Sites not aligning to the query:
5mrcY of the yeast mitochondrial ribosome - Class A (see paper)
55% identity, 87% coverage: 4:43/46 of query aligns to 6:45/46 of 5mrcY
- binding : T6 (= T4), Y7 (≠ F5), Q8 (= Q6), P9 (= P7), T11 (≠ V9), L12 (= L10), K13 (= K11), R14 (= R12), K15 (≠ N13), R16 (= R14), F18 (≠ H16), G19 (= G17), F20 (= F18), L21 (≠ R19), R23 (= R21), A24 (≠ M22), K25 (≠ A23), K27 (= K25), Q28 (≠ N26), S30 (≠ R28), K31 (≠ Q29), I32 (≠ V30), R35 (= R33), R36 (= R34), L38 (≠ A36), K39 (= K37), G40 (= G38), R41 (= R39), W42 (≠ T40)
Sites not aligning to the query:
Query Sequence
>EX31_RS25170
MKRTFQPSVLKRNRSHGFRARMATKNGRQVLARRRAKGRTRLSASK
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory