SitesBLAST
Comparing Echvi_0121 FitnessBrowser__Cola:Echvi_0121 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P56081 3-dehydroquinate synthase; DHQS; EC 4.2.3.4 from Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori) (see paper)
39% identity, 90% coverage: 28:337/345 of query aligns to 31:339/343 of P56081
6hqvA Pentafunctional arom complex from chaetomium thermophilum (see paper)
34% identity, 94% coverage: 10:332/345 of query aligns to 24:377/1555 of 6hqvA
- active site: R123 (= R105), K145 (= K127), E187 (= E169), K243 (= K206), E253 (= E216), R257 (= R220), N261 (= N224), H264 (= H227), H268 (= H231), H280 (= H246)
- binding glutamic acid: D139 (= D121), K145 (= K127), E187 (= E169), K243 (= K206), R257 (= R220), H264 (= H227), H280 (= H246)
- binding nicotinamide-adenine-dinucleotide: D42 (= D31), N44 (= N33), L45 (≠ T34), E76 (= E58), K79 (= K61), G107 (= G89), G108 (= G90), V109 (= V91), D112 (= D94), T132 (= T114), T133 (= T115), L135 (= L117), D139 (= D121), S140 (≠ A122), K145 (= K127), K154 (= K136), T175 (≠ S157), L176 (= L158), P177 (= P159), E180 (= E162), H280 (= H246)
- binding zinc ion: E187 (= E169), H264 (= H227), H280 (= H246)
Sites not aligning to the query:
- binding (4S,5R)-4,5-dihydroxy-3-oxocyclohex-1-ene-1-carboxylic acid: 1060, 1062, 1181, 1224, 1232, 1242, 1243
- binding (3r,4s,5r)-3,4,5-trihydroxycyclohex-1-ene-1-carboxylic acid: 413, 562, 563, 874, 923, 924, 979, 1277, 1279, 1323, 1327, 1348, 1368, 1526
6c5cA Crystal structure of the 3-dehydroquinate synthase (dhqs) domain of aro1 from candida albicans sc5314 in complex with nadh (see paper)
38% identity, 79% coverage: 52:322/345 of query aligns to 77:367/385 of 6c5cA
- active site: R130 (= R105), K152 (= K127), E194 (= E169), K246 (= K206), E254 (= E216), R258 (= R220), N262 (= N224), H265 (= H227), H269 (= H231), H281 (= H246)
- binding nicotinamide-adenine-dinucleotide: E83 (= E58), K86 (= K61), G114 (= G89), G115 (= G90), V116 (= V91), D119 (= D94), T139 (= T114), T140 (= T115), D146 (= D121), S147 (≠ A122), F179 (= F154), T182 (≠ S157), L183 (= L158), Q187 (≠ E162)
Sites not aligning to the query:
Q9KNV2 3-dehydroquinate synthase; DHQS; EC 4.2.3.4 from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)
37% identity, 79% coverage: 49:320/345 of query aligns to 63:338/361 of Q9KNV2
Sites not aligning to the query:
U3KRF2 3-dehydroquinate synthase, chloroplastic; EC 4.2.3.4 from Actinidia chinensis var. chinensis (Chinese soft-hair kiwi) (see paper)
43% identity, 62% coverage: 50:263/345 of query aligns to 147:363/445 of U3KRF2
Sites not aligning to the query:
3zokA Structure of 3-dehydroquinate synthase from actinidia chinensis in complex with NAD (see paper)
43% identity, 62% coverage: 50:263/345 of query aligns to 67:283/365 of 3zokA
- active site: R122 (= R105), K144 (= K127), E186 (= E169), K228 (= K206), E238 (= E216), R242 (= R220), N246 (= N224), H249 (= H227), H253 (= H231), H266 (= H246)
- binding glycine: K144 (= K127), K228 (= K206), R242 (= R220)
- binding nicotinamide-adenine-dinucleotide: D73 (≠ A56), E75 (= E58), K78 (= K61), G106 (= G89), G107 (= G90), V108 (= V91), D111 (= D94), T131 (= T114), T132 (= T115), M134 (≠ L117), D138 (= D121), S139 (≠ A122), K144 (= K127), K153 (= K136), T174 (≠ S157), L175 (= L158), E179 (= E162), H266 (= H246)
Sites not aligning to the query:
1dqsA Crystal structure of dehydroquinate synthase (dhqs) complexed with carbaphosphonate, NAD+ and zn2+ (see paper)
36% identity, 85% coverage: 28:320/345 of query aligns to 38:362/381 of 1dqsA
- active site: R127 (= R105), K149 (= K127), E191 (= E169), K240 (= K206), E250 (= E216), R254 (= R220), N258 (= N224), H261 (= H227), H265 (= H231), H277 (= H246)
- binding [1r-(1alpha,3beta,4alpha,5beta)]-5-(phosphonomethyl)-1,3,4-trihydroxycyclohexane-1-carboxylic acid: D143 (= D121), K149 (= K127), N159 (= N137), E191 (= E169), K240 (= K206), R254 (= R220), L257 (= L223), N258 (= N224), H261 (= H227), H265 (= H231), H277 (= H246), K346 (= K304)
- binding nicotinamide-adenine-dinucleotide: D41 (= D31), N43 (= N33), I44 (≠ T34), E78 (= E58), K81 (= K61), G111 (= G89), G112 (= G90), V113 (= V91), D116 (= D94), T136 (= T114), T137 (= T115), L139 (= L117), D143 (= D121), S144 (≠ A122), K158 (= K136), T179 (≠ S157), P181 (= P159), E184 (= E162), H277 (= H246)
- binding zinc ion: E191 (= E169), H261 (= H227), H277 (= H246)
1xagA Crystal structure of staphlyococcus aureus 3-dehydroquinate synthase (dhqs) in complex with zn2+, NAD+ and carbaphosphonate (see paper)
35% identity, 77% coverage: 56:322/345 of query aligns to 66:332/353 of 1xagA
- active site: R115 (= R105), K136 (= K127), E178 (= E169), K221 (= K206), E231 (= E216), R235 (= R220), N239 (= N224), H242 (= H227), H246 (= H231), H256 (= H246)
- binding [1r-(1alpha,3beta,4alpha,5beta)]-5-(phosphonomethyl)-1,3,4-trihydroxycyclohexane-1-carboxylic acid: K136 (= K127), N146 (= N137), E178 (= E169), K221 (= K206), R235 (= R220), L238 (= L223), N239 (= N224), H242 (= H227), H246 (= H231), K314 (= K304)
- binding nicotinamide-adenine-dinucleotide: E68 (= E58), K71 (= K61), G99 (= G89), G100 (= G90), A101 (≠ V91), D104 (= D94), T124 (= T114), T125 (= T115), L127 (= L117), D130 (= D121), S131 (≠ A122), K136 (= K127), K145 (= K136), T166 (≠ S157), L167 (= L158), Q171 (≠ E162), H256 (= H246)
- binding zinc ion: E178 (= E169), H242 (= H227), H256 (= H246)
Sites not aligning to the query:
Q6GGU4 3-dehydroquinate synthase; DHQS; EC 4.2.3.4 from Staphylococcus aureus (strain MRSA252) (see paper)
35% identity, 77% coverage: 56:322/345 of query aligns to 66:332/354 of Q6GGU4
Sites not aligning to the query:
3okfA 2.5 angstrom resolution crystal structure of 3-dehydroquinate synthase (arob) from vibrio cholerae
37% identity, 79% coverage: 49:320/345 of query aligns to 64:337/360 of 3okfA
- active site: R120 (= R105), K142 (= K127), E184 (= E169), K226 (= K206), R238 (= R220), N242 (= N224), H245 (= H227), H249 (= H231), H262 (= H246)
- binding nicotinamide-adenine-dinucleotide: D71 (≠ A56), E73 (= E58), K76 (= K61), G104 (= G89), G105 (= G90), V106 (= V91), D109 (= D94), T129 (= T114), T130 (= T115), L132 (= L117), D136 (= D121), T172 (≠ S157), L173 (= L158), E177 (= E162)
Sites not aligning to the query:
P07547 Pentafunctional AROM polypeptide; EC 4.2.3.4; EC 2.5.1.19; EC 2.7.1.71; EC 4.2.1.10; EC 1.1.1.25 from Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) (Aspergillus nidulans) (see 2 papers)
36% identity, 85% coverage: 28:320/345 of query aligns to 41:372/1583 of P07547
1nvbB Crystal structure of 3-dehydroquinate synthase (dhqs) in complex with zn2+ and carbaphosphonate (see paper)
36% identity, 85% coverage: 28:320/345 of query aligns to 39:370/391 of 1nvbB
- active site: R128 (= R105), K150 (= K127), E192 (= E169), K248 (= K206), E258 (= E216), R262 (= R220), N266 (= N224), H269 (= H227), H273 (= H231), H285 (= H246)
- binding [1r-(1alpha,3beta,4alpha,5beta)]-5-(phosphonomethyl)-1,3,4-trihydroxycyclohexane-1-carboxylic acid: D144 (= D121), K150 (= K127), N160 (= N137), E192 (= E169), K248 (= K206), R262 (= R220), L265 (= L223), N266 (= N224), H269 (= H227), H273 (= H231), K354 (= K304)
- binding zinc ion: E192 (= E169), H269 (= H227), H285 (= H246)
5eksA Structure of 3-dehydroquinate synthase from acinetobacter baumannii in complex with NAD
35% identity, 82% coverage: 57:338/345 of query aligns to 72:354/355 of 5eksA
- active site: R120 (= R105), K142 (= K127), E184 (= E169), K226 (= K206), R237 (= R220), N241 (= N224), H244 (= H227), H248 (= H231), H261 (= H246)
- binding magnesium ion: E184 (= E169), H244 (= H227), H261 (= H246)
- binding nicotinamide-adenine-dinucleotide: E73 (= E58), K76 (= K61), G104 (= G89), G105 (= G90), V106 (= V91), D109 (= D94), T129 (= T114), T130 (= T115), D136 (= D121), S137 (≠ A122), K142 (= K127), T172 (≠ S157), L173 (= L158), E177 (= E162)
Sites not aligning to the query:
Q5NFS1 3-dehydroquinate synthase; DHQS; EC 4.2.3.4 from Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4)
39% identity, 77% coverage: 54:320/345 of query aligns to 68:339/359 of Q5NFS1
Sites not aligning to the query:
3clhA Crystal structure of 3-dehydroquinate synthase (dhqs)from helicobacter pylori (see paper)
44% identity, 66% coverage: 28:254/345 of query aligns to 28:244/308 of 3clhA
- active site: R107 (= R105), K129 (= K127), E171 (= E169), K207 (= K206), R212 (= R220), N216 (= N224), H219 (= H227), H223 (= H231), H236 (= H246)
- binding nicotinamide-adenine-dinucleotide: I33 (≠ N33), V34 (≠ T34), H38 (≠ C38), S58 (≠ A56), E60 (= E58), K63 (= K61), G91 (= G89), G92 (= G90), V93 (= V91), D96 (= D94), T116 (= T114), T117 (= T115), L119 (= L117), D123 (= D121), A124 (= A122), K129 (= K127), N139 (= N137), T159 (≠ S157), L160 (= L158), E164 (= E162)
P9WPX9 3-dehydroquinate synthase; DHQS; EC 4.2.3.4 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
34% identity, 75% coverage: 58:316/345 of query aligns to 75:335/362 of P9WPX9
Sites not aligning to the query:
5hvnA 3.0 angstrom crystal structure of 3-dehydroquinate synthase (arob) from francisella tularensis in complex with NAD.
43% identity, 58% coverage: 54:254/345 of query aligns to 71:271/354 of 5hvnA
- active site: R123 (= R105), K145 (= K127), E187 (= E169), K228 (= K206), R239 (= R220), N243 (= N224), H246 (= H227), H250 (= H231), H263 (= H246)
- binding nicotinamide-adenine-dinucleotide: D73 (≠ A56), E75 (= E58), K78 (= K61), G107 (= G89), G108 (= G90), V109 (= V91), D112 (= D94), T132 (= T114), T133 (= T115), L135 (= L117), D139 (= D121), K145 (= K127), F172 (= F154), T175 (≠ S157), L176 (= L158), E180 (= E162)
Sites not aligning to the query:
6llaB Crystal structure of providencia alcalifaciens 3-dehydroquinate synthase (dhqs) in complex with mg2+ and NAD (see paper)
44% identity, 52% coverage: 57:235/345 of query aligns to 73:257/363 of 6llaB
- active site: R121 (= R105), K143 (= K127), E185 (= E169), K227 (= K206), E237 (= E216), R242 (= R220), N246 (= N224), H249 (= H227), H253 (= H231)
- binding magnesium ion: E185 (= E169), H249 (= H227)
- binding nicotinamide-adenine-dinucleotide: E74 (= E58), K77 (= K61), G105 (= G89), G106 (= G90), V107 (= V91), D110 (= D94), T130 (= T114), T131 (= T115), L133 (= L117), D137 (= D121), K143 (= K127), T173 (≠ S157), L174 (= L158), E178 (= E162)
Sites not aligning to the query:
1nvaA Crystal structure of 3-dehydroquinate synthase (dhqs) in complex with zn2+ and adp (see paper)
34% identity, 74% coverage: 28:284/345 of query aligns to 38:317/380 of 1nvaA
- active site: R127 (= R105), K149 (= K127), E191 (= E169), K247 (≠ V210), R257 (= R220), N261 (= N224), H264 (= H227), H268 (= H231), H280 (= H246)
- binding adenosine-5'-diphosphate: D41 (= D31), N43 (= N33), G111 (= G89), G112 (= G90), T136 (= T114), T137 (= T115), F176 (= F154), T179 (≠ S157), L180 (= L158)
- binding zinc ion: E191 (= E169), H264 (= H227), H280 (= H246)
3qbeA Crystal structure of the 3-dehydroquinate synthase (arob) from mycobacterium tuberculosis
33% identity, 75% coverage: 58:316/345 of query aligns to 70:326/352 of 3qbeA
- active site: R117 (= R105), K139 (= K127), E181 (= E169), K223 (= K206), R233 (= R220), N237 (= N224), H240 (= H227), H244 (= H231), H256 (= H246)
- binding zinc ion: E181 (= E169), H240 (= H227), H256 (= H246)
Query Sequence
>Echvi_0121 FitnessBrowser__Cola:Echvi_0121
MESIIFSTQIAPDLERFLKSKNFSKLGVITDSNTSQACYPLIREALPLHEHFAFEAGEVN
KNLDTCQKIWQWMTDCGFDRKSLIINLGGGVTGDMGGFCASTYKRGVKFINIPTTLLSQV
DASVGGKLGVDFNGFKNHIGVFNEPEAVIISAAFLSSLPLPELRSGYAEVLKHGLIRNEN
YFNSLKLQNWEDQRWTEIIEKSVYIKKDVVTKDPKEDGLRKILNFGHTVGHAVESFYLDT
ERHLLHGEAIAIGMIAEAYLSQKHIRLPKEELQSITTALLEVFGKVEIPKEDLDAIAQLC
FQDKKNDGKTINCSLLKKIGECDYNIAVSLDDIIDSLHFYNNQHS
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory