SitesBLAST
Comparing Echvi_1123 FitnessBrowser__Cola:Echvi_1123 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3e18A Crystal structure of NAD-binding protein from listeria innocua
29% identity, 97% coverage: 9:342/343 of query aligns to 8:347/348 of 3e18A
- active site: K94 (= K95), H178 (= H180)
- binding nicotinamide-adenine-dinucleotide: G12 (= G13), G13 (≠ R14), M14 (≠ V15), F34 (≠ V36), D35 (≠ E37), I36 (≠ R38), K40 (= K42), A70 (≠ C71), T71 (= T72), P72 (= P73), N73 (= N74), H76 (= H77), E93 (≠ D94), K94 (= K95), N122 (= N123), W161 (= W163), R162 (= R164), H178 (= H180)
3q2iA Crystal structure of the wlba dehydrognase from chromobactrium violaceum in complex with nadh and udp-glcnaca at 1.50 a resolution (see paper)
26% identity, 99% coverage: 3:343/343 of query aligns to 10:341/345 of 3q2iA
- active site: K104 (= K95), H192 (= H180)
- binding (2S,3S,4R,5R,6R)-5-acetamido-6-[[[(2R,3S,4R,5R)-5-(2,4-dioxopyrimidin-1-yl)-3,4-dihydroxy-oxolan-2-yl]methoxy-hydroxy-phosphoryl]oxy-hydroxy-phosphoryl]oxy-3,4-dihydroxy-oxane-2-carboxylic acid: K104 (= K95), N133 (= N123), T164 (≠ F155), R165 (= R156), Y169 (vs. gap), N188 (≠ D176), Q189 (≠ L177), H192 (= H180), K247 (= K237), N248 (≠ F238)
- binding 1,4-dihydronicotinamide adenine dinucleotide: C19 (≠ F12), G20 (= G13), R21 (= R14), I22 (≠ V15), D44 (≠ A34), I45 (≠ V35), T81 (= T72), P82 (= P73), S83 (≠ N74), H86 (= H77), E103 (≠ D94), K104 (= K95), Q132 (= Q122), W175 (= W163), R176 (= R164), H192 (= H180)
3q2kC Crystal structure of the wlba dehydrogenase from bordetella pertussis in complex with nadh and udp-glcnaca (see paper)
23% identity, 99% coverage: 3:343/343 of query aligns to 6:344/347 of 3q2kC
- active site: K100 (= K95), H188 (= H180)
- binding (2S,3S,4R,5R,6R)-5-acetamido-6-[[[(2R,3S,4R,5R)-5-(2,4-dioxopyrimidin-1-yl)-3,4-dihydroxy-oxolan-2-yl]methoxy-hydroxy-phosphoryl]oxy-hydroxy-phosphoryl]oxy-3,4-dihydroxy-oxane-2-carboxylic acid: R17 (= R14), K100 (= K95), W159 (≠ R154), T160 (≠ F155), R161 (= R156), Y165 (vs. gap), N184 (≠ D176), Q185 (≠ L177), H188 (= H180), Q243 (≠ L235), N244 (≠ P236)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G16 (= G13), R17 (= R14), I18 (≠ V15), D40 (≠ E37), T41 (≠ R38), A76 (≠ C71), T77 (= T72), S79 (≠ N74), H82 (= H77), Q85 (= Q80), E99 (≠ D94), K100 (= K95), Q128 (= Q122), W171 (= W163), R172 (= R164)
B3TMR8 dTDP-3,4-didehydro-2,6-dideoxy-alpha-D-glucose 3-reductase; 3-ketoreductase; NADPH-dependent C3-ketoreductase; EC 1.1.1.384 from Actinomadura kijaniata (see paper)
30% identity, 63% coverage: 2:218/343 of query aligns to 7:240/332 of B3TMR8
- 17:23 (vs. 12:18, 14% identical) binding
- SR 42:43 (≠ ER 37:38) binding
- Y63 (≠ L56) binding
- L79 (≠ T72) binding
- H84 (= H77) binding
- K102 (= K95) active site, Proton donor; mutation K->A,M,Q: Loss of reductase activity.; mutation to E: Retains some activity, but the catalytic efficiency is strongly reduced.
- R170 (= R164) binding
- D182 (= D176) binding
- Y186 (≠ H180) mutation to F: Same affinity for dTDP-glucose and NADPH compared to the wild-type. Small reduction of the catalytic efficiency resulting from the conformational flexibility of the nicotinamide ring.
3rc1A Crystal structure of kijd10, a 3-ketoreductase from actinomadura kijaniata incomplex with NADP and tdp-benzene (see paper)
30% identity, 63% coverage: 3:218/343 of query aligns to 1:233/325 of 3rc1A
- active site: K95 (= K95), Y179 (≠ H180)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: C10 (≠ F12), A11 (≠ G13), D12 (≠ R14), I13 (≠ V15), S35 (≠ E37), R36 (= R38), Y56 (≠ L56), P71 (≠ C71), L72 (≠ T72), P73 (= P73), H77 (= H77), E94 (≠ D94), K95 (= K95), I162 (≠ W163), R163 (= R164), V168 (≠ P169), D175 (= D176), Y179 (≠ H180)
- binding 5'-O-[(S)-hydroxy{[(S)-hydroxy(phenoxy)phosphoryl]oxy}phosphoryl]thymidine: R16 (≠ T18), R17 (≠ M19), F152 (= F152), I154 (≠ F155), P155 (≠ R156), Y233 (= Y218)
Sites not aligning to the query:
Q53TZ2 L-arabinose 1-dehydrogenase (NAD(P)(+)); D-galactose 1-dehydrogenase; EC 1.1.1.376; EC 1.1.1.120; EC 1.1.1.48 from Azospirillum brasilense (see paper)
33% identity, 52% coverage: 1:178/343 of query aligns to 1:171/309 of Q53TZ2
- M1 (= M1) modified: Initiator methionine, Removed
- D169 (= D176) mutation to A: Loss of activity.
Sites not aligning to the query:
- 173 N→A: Decrease by 4 orders of magnitude in catalytic efficiency.
5a06A Crystal structure of aldose-aldose oxidoreductase from caulobacter crescentus complexed with sorbitol (see paper)
27% identity, 85% coverage: 53:343/343 of query aligns to 59:336/336 of 5a06A
- active site: K101 (= K95), Y186 (≠ H180)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: Y59 (= Y53), I77 (≠ C71), T78 (= T72), P79 (= P73), N80 (= N74), L82 (≠ Y76), H83 (= H77), E100 (≠ D94), K101 (= K95), R129 (≠ Q122), W168 (= W163), R169 (= R164), Y186 (≠ H180), Y264 (≠ H269)
- binding sorbitol: D72 (= D66), H96 (= H90), K101 (= K95), R122 (vs. gap), R122 (vs. gap), L124 (= L117), F160 (= F152), R169 (= R164), D182 (= D176), Y186 (≠ H180), K287 (= K294), H296 (≠ N303), E299 (= E306), E306 (≠ T313), G310 (≠ K317), G311 (≠ P318)
Sites not aligning to the query:
5a05A Crystal structure of aldose-aldose oxidoreductase from caulobacter crescentus complexed with maltotriose (see paper)
27% identity, 85% coverage: 53:343/343 of query aligns to 58:335/335 of 5a05A
- active site: K100 (= K95), Y185 (≠ H180)
- binding beta-D-glucopyranose: K100 (= K95), F159 (= F152), D181 (= D176), Y185 (≠ H180)
- binding alpha-D-glucopyranose: P259 (= P265), S262 (≠ D268)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: Y58 (= Y53), I76 (≠ C71), T77 (= T72), P78 (= P73), N79 (= N74), L81 (≠ Y76), H82 (= H77), E99 (≠ D94), K100 (= K95), R128 (≠ Q122), W167 (= W163), R168 (= R164), Y185 (≠ H180), Y263 (≠ H269)
Sites not aligning to the query:
5a04A Crystal structure of aldose-aldose oxidoreductase from caulobacter crescentus complexed with glucose (see paper)
27% identity, 85% coverage: 53:343/343 of query aligns to 58:335/335 of 5a04A
- active site: K100 (= K95), Y185 (≠ H180)
- binding beta-D-glucopyranose: K100 (= K95), F159 (= F152), R168 (= R164), D181 (= D176), Y185 (≠ H180)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: Y58 (= Y53), I76 (≠ C71), T77 (= T72), P78 (= P73), N79 (= N74), L81 (≠ Y76), H82 (= H77), E99 (≠ D94), K100 (= K95), R128 (≠ Q122), W167 (= W163), R168 (= R164), Y185 (≠ H180), Y263 (≠ H269)
Sites not aligning to the query:
5a03E Crystal structure of aldose-aldose oxidoreductase from caulobacter crescentus complexed with xylose (see paper)
27% identity, 85% coverage: 53:343/343 of query aligns to 58:335/335 of 5a03E
- active site: K100 (= K95), Y185 (≠ H180)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: Y58 (= Y53), I76 (≠ C71), T77 (= T72), P78 (= P73), N79 (= N74), H82 (= H77), E99 (≠ D94), K100 (= K95), R128 (≠ Q122), W167 (= W163), R168 (= R164), Y185 (≠ H180), Y263 (≠ H269)
- binding beta-D-xylopyranose: K100 (= K95), F159 (= F152), R168 (= R164), D181 (= D176), Y185 (≠ H180), E205 (≠ I199), T207 (= T201), R209 (= R203)
- binding alpha-D-xylopyranose: H134 (≠ G128), M268 (≠ D274), R279 (≠ S287), E280 (≠ Y288)
Sites not aligning to the query:
5a03C Crystal structure of aldose-aldose oxidoreductase from caulobacter crescentus complexed with xylose (see paper)
27% identity, 85% coverage: 53:343/343 of query aligns to 59:336/336 of 5a03C
- active site: K101 (= K95), Y186 (≠ H180)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: Y59 (= Y53), I77 (≠ C71), T78 (= T72), P79 (= P73), N80 (= N74), L82 (≠ Y76), H83 (= H77), E100 (≠ D94), K101 (= K95), R129 (≠ Q122), W168 (= W163), R169 (= R164), Y186 (≠ H180), Y264 (≠ H269)
- binding beta-D-xylopyranose: K101 (= K95), F160 (= F152), R169 (= R164), D182 (= D176), Y186 (≠ H180)
Sites not aligning to the query:
5a02A Crystal structure of aldose-aldose oxidoreductase from caulobacter crescentus complexed with glycerol (see paper)
27% identity, 85% coverage: 53:343/343 of query aligns to 58:335/335 of 5a02A
- active site: K100 (= K95), Y185 (≠ H180)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: Y58 (= Y53), I76 (≠ C71), T77 (= T72), P78 (= P73), L81 (≠ Y76), H82 (= H77), E99 (≠ D94), K100 (= K95), R128 (≠ Q122), W167 (= W163), R168 (= R164), Y185 (≠ H180), Y263 (≠ H269)
Sites not aligning to the query:
7cgqA Crystal structure of azospirillum brasilense l-arabinose 1- dehydrogenase e147a mutant (NADP and l-arabinose bound form)
34% identity, 50% coverage: 8:178/343 of query aligns to 5:168/306 of 7cgqA
- binding alpha-L-arabinopyranose: K88 (= K95), H116 (≠ N123), H150 (≠ E158), P167 (≠ L177)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G10 (= G13), K11 (≠ R14), I12 (≠ V15), S34 (≠ E37), R35 (= R38), H36 (= H39), C64 (= C71), A65 (≠ T72), P66 (= P73), V69 (≠ Y76), E87 (≠ D94), K88 (= K95), H116 (≠ N123), Q153 (≠ E161), W155 (= W163), D166 (= D176)
Sites not aligning to the query:
3q2kK Crystal structure of the wlba dehydrogenase from bordetella pertussis in complex with nadh and udp-glcnaca (see paper)
22% identity, 99% coverage: 3:343/343 of query aligns to 1:319/322 of 3q2kK
- active site: K95 (= K95), H183 (= H180)
- binding (2S,3S,4R,5R,6R)-5-acetamido-6-[[[(2R,3S,4R,5R)-5-(2,4-dioxopyrimidin-1-yl)-3,4-dihydroxy-oxolan-2-yl]methoxy-hydroxy-phosphoryl]oxy-hydroxy-phosphoryl]oxy-3,4-dihydroxy-oxane-2-carboxylic acid: R12 (= R14), K95 (= K95), T155 (≠ F155), R156 (= R156), Y160 (vs. gap), N179 (≠ D176), Q180 (≠ L177), H183 (= H180), N239 (≠ P236)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G9 (= G11), G11 (= G13), R12 (= R14), I13 (≠ V15), D35 (≠ E37), T36 (≠ R38), T72 (= T72), P73 (= P73), S74 (≠ N74), L76 (≠ Y76), H77 (= H77), E94 (≠ D94), K95 (= K95), Q123 (= Q122), W166 (= W163), R167 (= R164), H183 (= H180)
7x2yA Crystal structure of cis-4,5-dihydrodiol phthalate dehydrogenase in complex with NAD+ and 3-hydroxybenzoate (see paper)
29% identity, 54% coverage: 5:190/343 of query aligns to 4:186/342 of 7x2yA
- binding 3-hydroxybenzoic acid: H122 (≠ Q122), Q173 (≠ L177), H176 (= H180)
- binding nicotinamide-adenine-dinucleotide: G10 (= G11), G12 (= G13), R13 (= R14), A14 (= A16), D35 (≠ E37), P36 (vs. gap), R37 (vs. gap), A71 (≠ C71), S72 (≠ T72), P73 (= P73), F76 (≠ Y76), Q80 (= Q80), E94 (≠ D94), K95 (= K95), P96 (= P96), R161 (≠ E158), P163 (≠ T160), E164 (= E161)
Sites not aligning to the query:
7xr9A Crystal structure of dgpa with glucose (see paper)
27% identity, 80% coverage: 59:334/343 of query aligns to 55:336/344 of 7xr9A
- binding beta-D-glucopyranose: K91 (= K95), R150 (= R154), W157 (= W163), F160 (vs. gap), D173 (= D176), H177 (= H180)
- binding nicotinamide-adenine-dinucleotide: C67 (= C71), T68 (= T72), P69 (= P73), H73 (= H77), E90 (≠ D94), K91 (= K95), P92 (= P96), Q119 (≠ N123), V159 (vs. gap), F160 (vs. gap), Q166 (≠ P169)
Sites not aligning to the query:
7xreC Crystal structure of dgpa
27% identity, 80% coverage: 59:334/343 of query aligns to 65:355/363 of 7xreC
- binding nicotinamide-adenine-dinucleotide: T78 (= T72), P79 (= P73), N80 (= N74), H83 (= H77), E100 (≠ D94), K101 (= K95), P102 (= P96), F170 (≠ W163), Q176 (≠ P169), H187 (= H180), Y313 (= Y300), F314 (≠ Y301)
Sites not aligning to the query:
6norA Crystal structure of gend2 from gentamicin a biosynthesis in complex with NAD (see paper)
23% identity, 94% coverage: 20:343/343 of query aligns to 27:347/349 of 6norA
- binding nicotinamide-adenine-dinucleotide: D44 (≠ E37), R45 (= R38), A80 (≠ C71), T81 (= T72), P82 (= P73), H86 (= H77), E103 (≠ D94), K104 (= K95), N132 (= N123), T169 (= T160), W171 (≠ N162), Y301 (= Y297)
Sites not aligning to the query:
6jw8A The crystal structure of kand2 in complex with nadh and 3"-deamino-3"- hydroxykanamycin b (see paper)
30% identity, 54% coverage: 4:189/343 of query aligns to 1:188/342 of 6jw8A
- binding (2S,3R,4S,5S,6R)-2-[(1S,2S,3R,4S,6R)-3-[(2R,3R,4R,5S,6R)-6-(aminomethyl)-3-azanyl-4,5-bis(oxidanyl)oxan-2-yl]oxy-4,6-bis(azanyl)-2-oxidanyl-cyclohexyl]oxy-6-(hydroxymethyl)oxane-3,4,5-triol: F11 (≠ R14), F152 (= F152), N154 (≠ R154), D175 (= D176), L176 (= L177), H179 (= H180)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G10 (= G13), F11 (≠ R14), M12 (≠ V15), D33 (≠ E37), L34 (≠ R38), T70 (≠ C71), T71 (= T72), P72 (= P73), N73 (= N74), L75 (≠ Y76), H76 (= H77), Q79 (= Q80), E93 (≠ D94), K94 (= K95), N122 (= N123), W161 (= W163), H179 (= H180)
Sites not aligning to the query:
- binding (2S,3R,4S,5S,6R)-2-[(1S,2S,3R,4S,6R)-3-[(2R,3R,4R,5S,6R)-6-(aminomethyl)-3-azanyl-4,5-bis(oxidanyl)oxan-2-yl]oxy-4,6-bis(azanyl)-2-oxidanyl-cyclohexyl]oxy-6-(hydroxymethyl)oxane-3,4,5-triol: 236, 271
- binding 1,4-dihydronicotinamide adenine dinucleotide: 290
6jw7A The crystal structure of kand2 in complex with nadh and 3"-deamino-3"- hydroxykanamycin a (see paper)
30% identity, 54% coverage: 4:189/343 of query aligns to 1:188/342 of 6jw7A
- binding (2R,3S,4S,5R,6R)-2-(aminomethyl)-6-[(1R,2S,3S,4R,6S)-4,6-bis(azanyl)-3-[(2S,3R,4S,5S,6R)-6-(hydroxymethyl)-3,4,5-tris(oxidanyl)oxan-2-yl]oxy-2-oxidanyl-cyclohexyl]oxy-oxane-3,4,5-triol: F11 (≠ R14), N154 (≠ R154), D175 (= D176), H179 (= H180)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G8 (= G11), G10 (= G13), F11 (≠ R14), M12 (≠ V15), D33 (≠ E37), L34 (≠ R38), T70 (≠ C71), T71 (= T72), P72 (= P73), N73 (= N74), L75 (≠ Y76), H76 (= H77), Q79 (= Q80), E93 (≠ D94), K94 (= K95), N122 (= N123), W161 (= W163)
Sites not aligning to the query:
- binding (2R,3S,4S,5R,6R)-2-(aminomethyl)-6-[(1R,2S,3S,4R,6S)-4,6-bis(azanyl)-3-[(2S,3R,4S,5S,6R)-6-(hydroxymethyl)-3,4,5-tris(oxidanyl)oxan-2-yl]oxy-2-oxidanyl-cyclohexyl]oxy-oxane-3,4,5-triol: 236, 271
- binding 1,4-dihydronicotinamide adenine dinucleotide: 290
Query Sequence
>Echvi_1123 FitnessBrowser__Cola:Echvi_1123
MTQPLKTGLVGFGRVAQTMHAPLIHQEPLLDLTAVVERHHQKSKEKYPAVTVYRSLEALL
AEADVDLIVICTPNEYHFSQAKMALEAGKHVVVDKPITVSSSEAEALLSLAKSKGKLLSA
FQNRRWDGDFQTITKLLHEGTLGRIVHFESHFDRFRPEPTENWREQQVPGSGILYDLGAH
LIDQALLLFGKPEWVYAEILTQRSGVEADDFFDLTLMYPTTKVRLSASILMNAPLPKFLV
LGDKGSYSKYGLDVQEAAFKAGILPGSDHWGEEDPSSYGKVYLEGTSYPYPTVKGNYLAY
YENIAETILGKATLKVKPEEAIEVLKVIEAAQKSHAEGKRVYL
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory