SitesBLAST
Comparing Echvi_1449 FitnessBrowser__Cola:Echvi_1449 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 18 hits to proteins with known functional sites (download)
3e9kA Crystal structure of homo sapiens kynureninase-3-hydroxyhippuric acid inhibitor complex (see paper)
48% identity, 96% coverage: 15:422/426 of query aligns to 29:444/446 of 3e9kA
- active site: F160 (= F134), D245 (= D219), Y270 (= Y244), K271 (= K245), R420 (= R398)
- binding 3-Hydroxyhippuric acid: S70 (= S44), F160 (= F134), H248 (= H222), K271 (= K245), R420 (= R398)
- binding pyridoxal-5'-phosphate: L132 (= L106), T133 (= T107), F160 (= F134), D163 (= D137), D245 (= D219), A247 (= A221), H248 (= H222), Y270 (= Y244), K271 (= K245)
P70712 Kynureninase; L-kynurenine hydrolase; EC 3.7.1.3 from Rattus norvegicus (Rat) (see paper)
47% identity, 97% coverage: 11:422/426 of query aligns to 30:458/464 of P70712
Sites not aligning to the query:
- 1 modified: N-acetylmethionine
2hzpA Crystal structure of homo sapiens kynureninase (see paper)
48% identity, 96% coverage: 15:422/426 of query aligns to 29:445/447 of 2hzpA
- active site: F160 (= F134), D245 (= D219), Y270 (= Y244), K271 (= K245), R421 (= R398)
- binding pyridoxal-5'-phosphate: L132 (= L106), T133 (= T107), F160 (= F134), D163 (= D137), D245 (= D219), A247 (= A221), H248 (= H222), Y270 (= Y244), K271 (= K245)
Q16719 Kynureninase; L-kynurenine hydrolase; EC 3.7.1.3 from Homo sapiens (Human) (see 4 papers)
48% identity, 96% coverage: 15:422/426 of query aligns to 34:458/465 of Q16719
- T138 (= T107) binding
- T198 (= T167) to A: in HYXKY; reduced 3-hydroxykynureninase activity; dbSNP:rs606231307
- D250 (= D219) binding
- H253 (= H222) binding
- Y275 (= Y244) binding
- W305 (= W275) binding
- N333 (= N303) binding
- K412 (= K376) to E: in dbSNP:rs9013
Sites not aligning to the query:
- 156:465 natural variant: Missing (in VCRL2; strongly reduced 3-hydroxykynureninase activity)
1qz9A The three dimensional structure of kynureninase from pseudomonas fluorescens (see paper)
31% identity, 96% coverage: 15:424/426 of query aligns to 10:400/404 of 1qz9A
- active site: F128 (= F134), D200 (= D219), Y225 (= Y244), K226 (= K245), R374 (= R398)
- binding pyridoxal-5'-phosphate: T95 (≠ S105), T96 (≠ L106), S97 (≠ T107), F128 (= F134), D131 (= D137), T171 (≠ A190), D200 (= D219), A202 (= A221), H203 (= H222), C223 (= C242), Y225 (= Y244), K226 (= K245)
P83788 Kynureninase; L-kynurenine hydrolase; EC 3.7.1.3 from Pseudomonas fluorescens (see paper)
31% identity, 96% coverage: 15:424/426 of query aligns to 11:401/416 of P83788
- T97 (≠ L106) binding
- S98 (≠ T107) binding
- D132 (= D137) mutation to A: Reduces binding to pyridoxal phosphate and strongly reduces catalytic activity.; mutation to E: Enhances binding to pyridoxal phosphate.
- T172 (≠ A190) binding
- D201 (= D219) binding ; mutation to E: Enhances binding to pyridoxal phosphate.
- H204 (= H222) binding
5xt6A A sulfur-transferring catalytic intermediate of sufs-sufu complex from bacillus subtilis (see paper)
21% identity, 94% coverage: 26:426/426 of query aligns to 8:404/405 of 5xt6A
- binding 2-[(3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridin-4-ylmethyl)-amino]-propionic acid: R55 (≠ D69), T93 (≠ L106), T94 (= T107), H122 (≠ F134), N174 (≠ G191), D199 (= D219), A201 (= A221), Q202 (≠ H222), S222 (≠ C242), H224 (≠ Y244), K225 (= K245), G275 (= G289), T276 (≠ F290), R357 (≠ F379), R377 (≠ I399)
7xepA Sufs with l-propargylglycine
21% identity, 94% coverage: 26:426/426 of query aligns to 9:405/408 of 7xepA
- binding [6-methyl-4-[[(5-methyl-2-oxidanylidene-furan-3-ylidene)amino]methyl]-5-oxidanyl-pyridin-3-yl]methyl dihydrogen phosphate: A30 (≠ N43), A31 (≠ S44), T94 (≠ L106), T95 (= T107), H123 (≠ F134), N175 (≠ G191), D200 (= D219), A202 (= A221), S223 (≠ C242), H225 (≠ Y244), K226 (= K245), R378 (≠ I399)
7xetA Sufs with beta-cyano-l-alanine
21% identity, 94% coverage: 26:426/426 of query aligns to 7:403/406 of 7xetA
- binding (2~{E})-3-cyano-2-[[2-methyl-3-oxidanyl-5-(phosphonooxymethyl)pyridin-4-yl]methylimino]propanoic acid: A28 (≠ N43), A29 (≠ S44), T93 (= T107), H121 (≠ F134), N173 (≠ G191), D198 (= D219), A200 (= A221), S221 (≠ C242), H223 (≠ Y244), K224 (= K245), R356 (≠ F379), R376 (≠ I399)
O32164 Cysteine desulfurase SufS; EC 2.8.1.7 from Bacillus subtilis (strain 168) (see 3 papers)
21% identity, 94% coverage: 26:426/426 of query aligns to 7:403/406 of O32164
- K224 (= K245) modified: N6-(pyridoxal phosphate)lysine
- C361 (≠ Q384) active site, Cysteine persulfide intermediate; mutation to A: Loss of cysteine desulfurase activity, still binds SufU and Cys.
5j8qA Crystal structure of the cysteine desulfurase sufs of bacillus subtilis (see paper)
21% identity, 94% coverage: 26:426/426 of query aligns to 7:403/413 of 5j8qA
- active site: H121 (≠ F134), D198 (= D219), A200 (= A221), Q201 (≠ H222), K224 (= K245), R356 (≠ F379), C361 (≠ Q384)
- binding alanine: A28 (≠ N43), A29 (≠ S44), H121 (≠ F134), H360 (≠ Y383), R376 (≠ I399)
- binding pyridoxal-5'-phosphate: T92 (≠ L106), T93 (= T107), H121 (≠ F134), D198 (= D219), A200 (= A221), S221 (≠ C242), H223 (≠ Y244), K224 (= K245)
7xekA Sufs with d-cysteine for 6 h
21% identity, 94% coverage: 26:426/426 of query aligns to 7:403/413 of 7xekA
- binding (2~{S},4~{S})-2-[2-methyl-3-oxidanyl-5-(phosphonooxymethyl)pyridin-4-yl]-1,3-thiazolidine-4-carboxylic acid: A28 (≠ N43), A29 (≠ S44), T92 (≠ L106), T93 (= T107), H121 (≠ F134), N173 (≠ G191), D198 (= D219), A200 (= A221), S221 (≠ C242), H223 (≠ Y244), K224 (= K245), R376 (≠ I399)
7xejA Sufs with d-cysteine for 5 min
21% identity, 94% coverage: 26:426/426 of query aligns to 7:403/413 of 7xejA
- binding (2~{S})-2-[(~{E})-[2-methyl-3-oxidanyl-5-(phosphonooxymethyl)pyridin-4-yl]methylideneamino]-3-sulfanyl-propanoic acid: A28 (≠ N43), A29 (≠ S44), T92 (≠ L106), T93 (= T107), H121 (≠ F134), N173 (≠ G191), D198 (= D219), A200 (= A221), S221 (≠ C242), H223 (≠ Y244), K224 (= K245), R376 (≠ I399)
5zsoA Sufs from bacillus subtilis, soaked with l-cysteine for 90 sec (see paper)
21% identity, 94% coverage: 26:426/426 of query aligns to 7:403/405 of 5zsoA
- binding n-({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)-l-cysteine: A28 (≠ N43), A29 (≠ S44), T92 (≠ L106), T93 (= T107), H121 (≠ F134), N173 (≠ G191), D198 (= D219), A200 (= A221), S221 (≠ C242), K224 (= K245), R356 (≠ F379), C361 (≠ Q384), R376 (≠ I399)
7cepA Crystal structure of l-cycloserine-bound form of cysteine desulfurase sufs from bacillus subtilis (see paper)
21% identity, 94% coverage: 26:426/426 of query aligns to 9:405/414 of 7cepA
- binding (5-hydroxy-6-methyl-4-{[(3-oxo-2,3-dihydro-1,2-oxazol-4-yl)amino]methyl}pyridin-3-yl)methyl dihydrogen phosphate: A30 (≠ N43), A31 (≠ S44), T94 (≠ L106), T95 (= T107), H123 (≠ F134), N175 (≠ G191), D200 (= D219), A202 (= A221), S223 (≠ C242), H225 (≠ Y244), K226 (= K245), R378 (≠ I399)
7ceoA Crystal structure of pmp-bound form of cysteine desulfurase sufs from bacillus subtilis (see paper)
21% identity, 94% coverage: 26:426/426 of query aligns to 7:403/412 of 7ceoA
7xenA Sufs with l-penicillamine
21% identity, 94% coverage: 26:426/426 of query aligns to 7:390/392 of 7xenA
- binding (2~{R})-3-methyl-2-[(~{E})-[2-methyl-3-oxidanyl-5-(phosphonooxymethyl)pyridin-4-yl]methylideneamino]-3-sulfanyl-butanoic acid: A28 (≠ N43), A29 (≠ S44), T79 (≠ L106), T80 (= T107), H108 (≠ F134), N160 (≠ G191), D185 (= D219), A187 (= A221), Q188 (≠ H222), S208 (≠ C242), K211 (= K245), H347 (≠ Y383), R363 (≠ I399)
7cerA Crystal structure of d-cycloserine-bound form of cysteine desulfurase sufs h121a from bacillus subtilis (see paper)
21% identity, 94% coverage: 26:426/426 of query aligns to 9:405/414 of 7cerA
- binding d-[3-hydroxy-2-methyl-5-phosphonooxymethyl-pyridin-4-ylmethyl]-n,o-cycloserylamide: A30 (≠ N43), T94 (≠ L106), T95 (= T107), N175 (≠ G191), D200 (= D219), A202 (= A221), S223 (≠ C242), H225 (≠ Y244), K226 (= K245), R358 (≠ F379), R378 (≠ I399)
Query Sequence
>Echvi_1449 FitnessBrowser__Cola:Echvi_1449
MSSYRYSLAFAQERDREDPLRKFQSRFHFPKVNGEAAIYFCGNSLGLQPKAVREHLDRDL
ESWASKAVDGHFEGDAPWFSVHERSKAALAEIVGAKKHEVVAMGSLTTNLHALLVSFYQP
NGKRNKILTEAGAFPSDMYALESQVKYHGLDPDEAIVEVGPRPGEHTIRTEDILQAISKH
QDELACVMMAGLQYYTGQVFDMKAIASAAHAVGATVGFDLAHAAGNAPLHLHDWGVDFAA
WCSYKYLNSGPGNVAGIFVHERHGNNPALNRFAGWWGHDEKVRFKMEKGFVPMYGADGWQ
NSNGNVLGMAAHQASLDIFQEAGMVHLRKKSVQLTGFLAFLIREISGESGVLEVITPNAE
AERGCQLSLLIHKGGKAVFDEFYQNGIVGDWRNPNVIRIAPTPLYNSFEDVFRFAKILEQ
SLSKFA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory