Comparing Echvi_1798 FitnessBrowser__Cola:Echvi_1798 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3bjeA Crystal structure of trypanosoma brucei nucleoside phosphorylase shows uridine phosphorylase activity (see paper)
32% identity, 89% coverage: 9:264/287 of query aligns to 1:298/327 of 3bjeA
3qpbC Crystal structure of streptococcus pyogenes uridine phosphorylase reveals a subclass of the np-i superfamily (see paper)
34% identity, 45% coverage: 19:148/287 of query aligns to 9:124/254 of 3qpbC
Sites not aligning to the query:
6k8pA Structural and catalytic analysis of two diverse uridine phosphorylases in the oomycete phytophthora capsici. (see paper)
26% identity, 92% coverage: 15:279/287 of query aligns to 13:277/294 of 6k8pA
6k5kA Structural and catalytic analysis of two diverse uridine phosphorylases in the oomycete phytophthora capsici. (see paper)
33% identity, 41% coverage: 15:132/287 of query aligns to 6:113/287 of 6k5kA
Sites not aligning to the query:
6k5hA Structural and catalytic analysis of two diverse uridine phosphorylases in the oomycete phytophthora capsici. (see paper)
33% identity, 41% coverage: 15:132/287 of query aligns to 6:113/287 of 6k5hA
Sites not aligning to the query:
6k8pB Structural and catalytic analysis of two diverse uridine phosphorylases in the oomycete phytophthora capsici. (see paper)
31% identity, 40% coverage: 17:132/287 of query aligns to 1:106/280 of 6k8pB
Sites not aligning to the query:
4mchA Crystal structure of uridine phosphorylase from vibrio fischeri es114 complexed with 6-hydroxy-1-naphthoic acid, nysgrc target 029520.
29% identity, 41% coverage: 20:138/287 of query aligns to 11:115/243 of 4mchA
Sites not aligning to the query:
3uaxA Crystal structure of adenosine phosphorylase from bacillus cereus complexed with inosine (see paper)
35% identity, 37% coverage: 20:126/287 of query aligns to 3:97/226 of 3uaxA
Sites not aligning to the query:
4yjkA Crystal structure of c212s mutant of shewanella oneidensis mr-1 uridine phosphorylase (see paper)
24% identity, 86% coverage: 18:263/287 of query aligns to 3:220/245 of 4yjkA
4danA Crystal structure of the hexameric purine nucleoside phosphorylase from bacillus subtilis in complex with 2-fluoroadenosine (see paper)
27% identity, 83% coverage: 20:256/287 of query aligns to 3:197/229 of 4danA
Sites not aligning to the query:
3uawA Crystal structure of adenosine phosphorylase from bacillus cereus complexed with adenosine (see paper)
35% identity, 37% coverage: 20:126/287 of query aligns to 3:97/233 of 3uawA
Sites not aligning to the query:
4da0A Crystal structure of the hexameric purine nucleoside phosphorylase from bacillus subtilis in complex with 2'-deoxyguanosine (see paper)
27% identity, 83% coverage: 20:256/287 of query aligns to 3:197/230 of 4da0A
Sites not aligning to the query:
4daeA Crystal structure of the hexameric purine nucleoside phosphorylase from bacillus subtilis in complex with 6-chloroguanosine (see paper)
27% identity, 83% coverage: 20:256/287 of query aligns to 4:198/232 of 4daeA
Sites not aligning to the query:
4darA Crystal structure of the hexameric purine nucleoside phosphorylase from bacillus subtilis in complex with tubercidin (see paper)
27% identity, 83% coverage: 20:256/287 of query aligns to 3:197/231 of 4darA
Sites not aligning to the query:
4dabA Crystal structure of the hexameric purine nucleoside phosphorylase from bacillus subtilis in complex with hypoxanthine (see paper)
27% identity, 83% coverage: 20:256/287 of query aligns to 3:197/231 of 4dabA
Sites not aligning to the query:
4da8A Crystal structure of the hexameric purine nucleoside phosphorylase from bacillus subtilis in complex with 8-bromoguanosine (see paper)
27% identity, 83% coverage: 20:256/287 of query aligns to 3:197/231 of 4da8A
Sites not aligning to the query:
4da7A Crystal structure of the hexameric purine nucleoside phosphorylase from bacillus subtilis in complex with aciclovir (see paper)
27% identity, 83% coverage: 20:256/287 of query aligns to 3:197/231 of 4da7A
Sites not aligning to the query:
4da6A Crystal structure of the hexameric purine nucleoside phosphorylase from bacillus subtilis in complex with ganciclovir (see paper)
27% identity, 83% coverage: 20:256/287 of query aligns to 3:197/231 of 4da6A
Sites not aligning to the query:
4d9hA Crystal structure of the hexameric purine nucleoside phosphorylase from bacillus subtilis in complex with adenosine (see paper)
27% identity, 83% coverage: 20:256/287 of query aligns to 3:197/231 of 4d9hA
Sites not aligning to the query:
4d8vA Crystal structure of the hexameric purine nucleoside phosphorylase from bacillus subtilis at ph 4.2 (see paper)
27% identity, 83% coverage: 20:256/287 of query aligns to 3:197/231 of 4d8vA
Sites not aligning to the query:
>Echvi_1798 FitnessBrowser__Cola:Echvi_1798
MTKVIPASELIINPDGSIYHLNLKPEFLASNVITVGDPERVPKISQYFDHVDIKVAKREF
VTHTGTYKGKRLSVMSTGMGTDNIEIFMTELDALVNIDLQTRQVKPKHTALNIVRVGTSG
SMREEIPAGALVASEYAVGLDTLMQYYAADYSDKEQAIREAVQQSLGVDFLPYCFEGSKK
LLGQMNTKDMILGNTATCPGFFGPQGREVRLKPAIPDIIERLSAMEVDGFQLTNFEMETA
GYYAMGKMLGHEVLSLNAIVANRITHTFVGNPSEVVDHLIHHTLEHI
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory