SitesBLAST
Comparing Echvi_1808 FitnessBrowser__Cola:Echvi_1808 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 5 hits to proteins with known functional sites (download)
Q47945 Alcohol dehydrogenase (quinone), cytochrome c subunit; ADH; Alcohol dehydrogenase (quinone), subunit II; Cytochrome c-553; Cytochrome c553; Ethanol:Q2 reductase; G3-ADH subunit II; Quinohemoprotein-cytochrome c complex; Ubiquinol oxidase; EC 1.1.5.5 from Gluconobacter oxydans (strain 621H) (Gluconobacter suboxydans) (see paper)
31% identity, 67% coverage: 48:267/330 of query aligns to 44:265/478 of Q47945
Sites not aligning to the query:
- 1:36 signal peptide
- 37 modified: Pyrrolidone carboxylic acid
8gy2B Cryo-em structure of membrane-bound alcohol dehydrogenase from gluconobacter oxydans
31% identity, 67% coverage: 48:267/330 of query aligns to 6:227/433 of 8gy2B
- binding heme c: C18 (= C61), C21 (= C64), H22 (= H65), T46 (≠ P102), I48 (= I104), Y59 (≠ W112), L68 (≠ I121), R73 (≠ K126), V79 (≠ I132), Y80 (≠ F133), M83 (= M136), F88 (≠ Y141), R126 (vs. gap), H165 (≠ A209), C166 (= C210), C169 (= C213), H170 (= H214), I201 (≠ V241), A202 (≠ R242), P203 (≠ S243), L205 (≠ N245), W216 (≠ K256), F224 (≠ Q264)
- binding ubiquinone-10: C21 (= C64), L34 (≠ D87), P39 (≠ S92), P81 (= P134), L129 (vs. gap), W132 (≠ I179), E168 (= E212), R173 (≠ F217), I197 (≠ N237)
Sites not aligning to the query:
- binding heme c: 234, 235, 236, 236, 239, 301, 302, 305, 306, 316, 317, 318, 320, 324, 342, 352, 354, 356, 359, 375, 428
- binding ubiquinone-10: 241
7w2jC Cryo-em structure of membrane-bound fructose dehydrogenase from gluconobacter japonicus
29% identity, 80% coverage: 48:310/330 of query aligns to 1:254/418 of 7w2jC
- binding heme c: C13 (= C61), C16 (= C64), H17 (= H65), T42 (≠ P102), I44 (= I104), Y55 (≠ W112), L75 (≠ I132), Y76 (≠ F133), A78 (≠ V135), M79 (= M136), R122 (= R180), H161 (≠ A209), C162 (= C210), C165 (= C213), H166 (= H214), A191 (≠ N237), P192 (≠ G238), R223 (≠ V278), P227 (≠ E282), M228 (≠ F283)
Sites not aligning to the query:
- binding heme c: 289, 290, 293, 294, 305, 306, 307, 309, 312, 313, 314, 322, 327, 331, 333, 340, 342, 343, 345
8jejC Cryo-em structure of na-dithionite reduced membrane-bound fructose dehydrogenase from gluconobacter japonicus
29% identity, 80% coverage: 48:310/330 of query aligns to 1:254/413 of 8jejC
- binding heme c: C13 (= C61), C16 (= C64), H17 (= H65), T42 (≠ P102), I44 (= I104), F60 (≠ L117), L64 (≠ I121), L75 (≠ I132), Y76 (≠ F133), M79 (= M136), P80 (= P137), Y84 (= Y141), R122 (= R180), C162 (= C210), C165 (= C213), H166 (= H214), I186 (≠ A232), W189 (≠ S235), A191 (≠ N237), P192 (≠ G238), I194 (= I240), W205 (≠ K256), Y213 (= Y268), R223 (≠ V278), M228 (≠ F283)
- binding ubiquinone-10: M36 (= M93), P77 (= P134), S124 (≠ M182), W128 (≠ A186), C165 (= C213), L173 (≠ K219)
Sites not aligning to the query:
- binding heme c: 303, 304, 307, 308, 320, 321, 323, 327, 328, 336, 341, 345, 347, 354, 356, 359, 376
- binding ubiquinone-10: 408, 411
8gy3A Cryo-em structure of membrane-bound aldehyde dehydrogenase from gluconobacter oxydans
29% identity, 52% coverage: 44:215/330 of query aligns to 37:208/440 of 8gy3A
- binding heme c: Y52 (≠ L60), C53 (= C61), C56 (= C64), H57 (= H65), S84 (≠ P102), I86 (= I104), W97 (= W112), F102 (≠ L117), L117 (≠ I132), F121 (≠ M136), F126 (≠ Y141), R163 (vs. gap), C203 (= C210), C206 (= C213), H207 (= H214)
- binding ubiquinone-10: E55 (≠ D63), T76 (≠ L95), F78 (vs. gap), Y118 (≠ F133), P119 (= P134), I160 (≠ V175), G166 (vs. gap), Q167 (vs. gap), F169 (= F177), W170 (≠ I178), H202 (≠ A209)
Sites not aligning to the query:
- binding heme c: 232, 233, 235, 245, 253, 254, 263, 264, 269, 292, 337, 340, 341, 353, 355, 358, 359, 372, 377, 382, 383, 386, 388, 391
- binding ubiquinone-10: 210, 213
Query Sequence
>Echvi_1808 FitnessBrowser__Cola:Echvi_1808
MKKLAKIILYGTAIFIAILIIAGIYMKTVLPNVGDPEELEIEGSTEQIARGEYLANHVML
CMDCHSDRNYSLFSGPPHPGTKGLGGDRFDRSMGLPGVFVSPNITPEGIGNWTDGELYRL
ITTGVKKNGEPIFPVMPYQSYGKLDPEDIKAVIAYIRTLAPQKSNIPPREIDFPVNFIIR
TMPSKATPTTRPNKEDVIAYGEYLVTAAACGECHTKFEKGKFVGPYLGGGRAFPSPNGNI
VRSSNLTFHSTGLGNKSKEDFVRQFKQYSPELYTPTKVGEGEFQTIMPWTMYAGMDTTDL
ASIYEYLRSLEPINNPIEKVTFAKINSNTE
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory