Comparing Echvi_1875 FitnessBrowser__Cola:Echvi_1875 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P09099 Xylulose kinase; XK; Xylulokinase; 1-deoxy-D-xylulokinase; EC 2.7.1.17; EC 2.7.1.- from Escherichia coli (strain K12) (see paper)
28% identity, 98% coverage: 4:487/496 of query aligns to 1:478/484 of P09099
2itmA Crystal structure of the e. Coli xylulose kinase complexed with xylulose (see paper)
28% identity, 98% coverage: 4:487/496 of query aligns to 1:470/476 of 2itmA
3i8bA The crystal structure of xylulose kinase from bifidobacterium adolescentis
25% identity, 82% coverage: 1:408/496 of query aligns to 2:427/506 of 3i8bA
3ll3B The crystal structure of ligand bound xylulose kinase from lactobacillus acidophilus
26% identity, 98% coverage: 3:490/496 of query aligns to 2:477/490 of 3ll3B
3ll3A The crystal structure of ligand bound xylulose kinase from lactobacillus acidophilus
26% identity, 98% coverage: 3:490/496 of query aligns to 3:479/492 of 3ll3A
6k76A Glycerol kinase form thermococcus kodakarensis, complex structure with substrate.
24% identity, 99% coverage: 6:494/496 of query aligns to 2:476/485 of 6k76A
5ya2A Crystal structure of lsrk-hpr complex with adp (see paper)
23% identity, 97% coverage: 5:483/496 of query aligns to 5:474/478 of 5ya2A
5ya1A Crystal structure of lsrk-hpr complex with atp (see paper)
23% identity, 97% coverage: 5:483/496 of query aligns to 5:474/478 of 5ya1A
3kzbA Crystal structure of xylulokinase from chromobacterium violaceum
25% identity, 70% coverage: 8:356/496 of query aligns to 9:355/498 of 3kzbA
Sites not aligning to the query:
O86033 Glycerol kinase; ATP:glycerol 3-phosphotransferase; Glycerokinase; GK; EC 2.7.1.30 from Rhizobium meliloti (strain 1021) (Ensifer meliloti) (Sinorhizobium meliloti)
26% identity, 53% coverage: 5:266/496 of query aligns to 5:265/497 of O86033
3l0qA The crystal structure of xlylulose kinase from yersinia pseudotuberculosis
23% identity, 99% coverage: 5:493/496 of query aligns to 4:535/541 of 3l0qA
O34154 Glycerol kinase; ATP:glycerol 3-phosphotransferase; Glycerokinase; GK; EC 2.7.1.30 from Enterococcus faecalis (strain ATCC 700802 / V583) (see 2 papers)
24% identity, 53% coverage: 2:266/496 of query aligns to 4:267/501 of O34154
Sites not aligning to the query:
6udeB Crystal structure of glycerol kinase from elizabethkingia anophelis nuhp1 in complex with adp and glycerol
25% identity, 80% coverage: 3:401/496 of query aligns to 3:391/495 of 6udeB
Sites not aligning to the query:
Q5HGD2 Glycerol kinase; ATP:glycerol 3-phosphotransferase; Glycerokinase; GK; EC 2.7.1.30 from Staphylococcus aureus (strain COL)
25% identity, 54% coverage: 1:268/496 of query aligns to 1:268/498 of Q5HGD2
Sites not aligning to the query:
3ge1A 2.7 angstrom crystal structure of glycerol kinase (glpk) from staphylococcus aureus in complex with adp and glycerol
25% identity, 54% coverage: 1:268/496 of query aligns to 2:269/499 of 3ge1A
Sites not aligning to the query:
P18157 Glycerol kinase; ATP:glycerol 3-phosphotransferase; Glycerokinase; GK; EC 2.7.1.30 from Bacillus subtilis (strain 168) (see paper)
25% identity, 54% coverage: 1:266/496 of query aligns to 1:266/496 of P18157
1gllO Escherichia coli glycerol kinase mutant with bound atp analog showing substantial domain motion (see paper)
23% identity, 55% coverage: 2:272/496 of query aligns to 2:261/494 of 1gllO
Sites not aligning to the query:
1gljO Escherichia coli glycerol kinase mutant with bound atp analog showing substantial domain motion (see paper)
23% identity, 55% coverage: 2:272/496 of query aligns to 2:261/494 of 1gljO
Sites not aligning to the query:
1bwfO Escherichia coli glycerol kinase mutant with bound atp analog showing substantial domain motion (see paper)
23% identity, 55% coverage: 2:272/496 of query aligns to 2:261/494 of 1bwfO
Sites not aligning to the query:
1glfO Crystal structures of escherichia coli glycerol kinase and the mutant a65t in an inactive tetramer: conformational changes and implications for allosteric regulation (see paper)
23% identity, 55% coverage: 2:273/496 of query aligns to 2:266/498 of 1glfO
Sites not aligning to the query:
>Echvi_1875 FitnessBrowser__Cola:Echvi_1875
MRKLFIGYDIGSSSVKATLLDGDTGKVVASDGQPKIEMPIDSPQKDWAEQDPQMWWKYVI
ETTQAIIQQGGVKPGELQAIGISYQMHGLVMVDKEQQVIRPSIIWCDSRAVETGNSAFEA
LGSEFCLSHLLNSPGNFTASKLKWVKDHEPANYEKIHKVMLPGDFIAMKLTGEIFTSESG
LSEGVFWDFKENRVSQPLLDHYGIDREILATAIPSFAEGGKVNAAAAKVLGIAEGIPVTY
RAGDQPNNAFSLNVLEAGELATTAGTSGTVYGVSSSPVYDPQSRVNTFLHVNHMADNPHY
GVLLCVNGTGILNSWLKKMLGGESIDYEAMNKLAAEVPVGAEGLSFVPFGNGAERIMENK
TVGAHLAGLNLLKHDKRHVLRAGQEGIVSALTFGFNIMKNMGLTLDTVKAGRANMFLSPL
FREAFVNMNEVNLEFYDTDGSQGAARGAGVGAKHFASPQEAFNGLEKVASYVPEPKLVSA
YKEVYQQWEERLRKIQ
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory