Comparing Echvi_2001 FitnessBrowser__Cola:Echvi_2001 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 10 hits to proteins with known functional sites (download)
P00547 Homoserine kinase; HK; HSK; EC 2.7.1.39 from Escherichia coli (strain K12) (see paper)
37% identity, 89% coverage: 4:280/311 of query aligns to 2:281/310 of P00547
Q8L7R2 Homoserine kinase; Protein DOWNY MILDEW RESISTANT 1; EC 2.7.1.39 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
39% identity, 98% coverage: 4:309/311 of query aligns to 54:366/370 of Q8L7R2
Sites not aligning to the query:
1h74B Crystal structure of homoserine kinase complexed with ile (see paper)
35% identity, 92% coverage: 3:287/311 of query aligns to 2:282/296 of 1h74B
1h74A Crystal structure of homoserine kinase complexed with ile (see paper)
35% identity, 92% coverage: 3:287/311 of query aligns to 2:282/296 of 1h74A
1h73A Crystal structure of homoserine kinase complexed with threonine (see paper)
35% identity, 92% coverage: 3:287/311 of query aligns to 2:282/296 of 1h73A
1h72C Crystal structure of homoserine kinase complexed with hse (see paper)
35% identity, 92% coverage: 3:287/311 of query aligns to 2:282/296 of 1h72C
1fwkA Crystal structure of homoserine kinase complexed with adp (see paper)
35% identity, 92% coverage: 3:287/311 of query aligns to 2:282/296 of 1fwkA
6cyzA Mycobacterial homoserine kinase thrb in complex with amppnp
30% identity, 85% coverage: 5:268/311 of query aligns to 11:263/295 of 6cyzA
4utgA Burkholderia pseudomallei heptokinase wcbl,amppnp (atp analogue) complex. (see paper)
32% identity, 30% coverage: 81:174/311 of query aligns to 101:197/345 of 4utgA
Sites not aligning to the query:
4ut4A Burkholderia pseudomallei heptokinase wcbl, d-mannose complex. (see paper)
32% identity, 30% coverage: 81:174/311 of query aligns to 101:197/345 of 4ut4A
Sites not aligning to the query:
>Echvi_2001 FitnessBrowser__Cola:Echvi_2001
MKKVTAFAPATVANVSCGFDILGFAVEEMGDKVTVSLADEPGVRVVRIEGDGGRLPYEVD
KNTCGVALKAFLAAIDYKGGLEVELYKGLPLGSGMGSSAASSVAALEAANQLLGNPLDKK
ALLPFAMKAEGVACGAEHADNVAPSLLGGFVLIRSYHPLDVTKLHVPKGLYCALVHPHLE
LNTADSRSVLRQQVPLKDAITQSGNIAGLVAGLYQEDMGLISRSLQDVIAEPSRSVLIPG
FDEIKSAIKEVGALGVGISGSGPTTFILAPSREVAERASEICQEVFDKIGLEVDLYVSAV
NTKGTYVINKA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory