SitesBLAST
Comparing Echvi_2468 FitnessBrowser__Cola:Echvi_2468 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1cevA Arginase from bacillus caldovelox, native structure at ph 5.6 (see paper)
34% identity, 97% coverage: 1:307/316 of query aligns to 1:292/299 of 1cevA
- active site: H99 (= H97), D122 (= D122), H124 (= H124), D126 (= D126), H139 (= H139), D226 (= D241), D228 (= D243), E271 (= E286)
- binding manganese (ii) ion: H99 (= H97), D122 (= D122), D122 (= D122), H124 (= H124), D126 (= D126), D226 (= D241), D226 (= D241), D228 (= D243)
P53608 Arginase; EC 3.5.3.1 from Bacillus caldovelox (see paper)
34% identity, 97% coverage: 1:307/316 of query aligns to 1:292/299 of P53608
6dktA Crystal structure of arginase from bacillus subtilis
35% identity, 97% coverage: 2:307/316 of query aligns to 1:276/283 of 6dktA
6nfpD 1.7 angstrom resolution crystal structure of arginase from bacillus subtilis subsp. Subtilis str. 168
35% identity, 97% coverage: 2:307/316 of query aligns to 4:282/289 of 6nfpD
5cevA Arginase from bacillus caldevelox, l-lysine complex (see paper)
34% identity, 96% coverage: 4:307/316 of query aligns to 3:291/298 of 5cevA
- active site: H98 (= H97), D121 (= D122), H123 (= H124), D125 (= D126), H138 (= H139), D225 (= D241), D227 (= D243), E270 (= E286)
- binding guanidine: H251 (≠ K268), E255 (= E272)
- binding lysine: S134 (= S135), H138 (= H139), E270 (= E286)
- binding manganese (ii) ion: H98 (= H97), D121 (= D122), D121 (= D122), H123 (= H124), D125 (= D126), D225 (= D241), D225 (= D241), D227 (= D243)
4cevA Arginase from bacillus caldevelox, l-ornithine complex (see paper)
34% identity, 96% coverage: 4:307/316 of query aligns to 3:291/298 of 4cevA
- active site: H98 (= H97), D121 (= D122), H123 (= H124), D125 (= D126), H138 (= H139), D225 (= D241), D227 (= D243), E270 (= E286)
- binding guanidine: H251 (≠ K268), E255 (= E272)
- binding manganese (ii) ion: H98 (= H97), D121 (= D122), D121 (= D122), H123 (= H124), D125 (= D126), D225 (= D241), D225 (= D241), D227 (= D243)
- binding L-ornithine: H123 (= H124), D125 (= D126), S134 (= S135), H138 (= H139), D177 (≠ E194)
3cevA Arginase from bacillus caldevelox, complexed with l-arginine (see paper)
34% identity, 96% coverage: 4:307/316 of query aligns to 3:291/298 of 3cevA
- active site: H98 (= H97), D121 (= D122), H123 (= H124), D125 (= D126), H138 (= H139), D225 (= D241), D227 (= D243), E270 (= E286)
- binding arginine: H123 (= H124), D125 (= D126), S134 (= S135), H138 (= H139), D225 (= D241), H251 (≠ K268), E255 (= E272), E270 (= E286)
- binding manganese (ii) ion: H98 (= H97), D121 (= D122), D125 (= D126), D225 (= D241)
Sites not aligning to the query:
2cevB Arginase from bacillus caldevelox, native structure at ph 8.5 (see paper)
34% identity, 96% coverage: 4:307/316 of query aligns to 3:291/298 of 2cevB
- active site: H98 (= H97), D121 (= D122), H123 (= H124), D125 (= D126), H138 (= H139), D225 (= D241), D227 (= D243), E270 (= E286)
- binding guanidine: H251 (≠ K268), E255 (= E272)
- binding manganese (ii) ion: H98 (= H97), D121 (= D122), D121 (= D122), H123 (= H124), D125 (= D126), D225 (= D241), D225 (= D241), D227 (= D243)
6nfpA 1.7 angstrom resolution crystal structure of arginase from bacillus subtilis subsp. Subtilis str. 168
35% identity, 97% coverage: 2:307/316 of query aligns to 1:285/292 of 6nfpA
6nbkA Crystal structure of arginase from bacillus cereus
31% identity, 97% coverage: 2:307/316 of query aligns to 1:282/289 of 6nbkA
4q41A Crystal structure of schistosoma mansoni arginase in complex with l- lysine (see paper)
39% identity, 69% coverage: 76:294/316 of query aligns to 81:287/333 of 4q41A
- active site: H103 (= H97), D126 (= D122), H128 (= H124), D130 (= D126), H143 (= H139), D234 (= D241), D236 (= D243), E279 (= E286)
- binding lysine: N132 (≠ H128), H143 (= H139), D185 (≠ E194)
- binding manganese (ii) ion: H103 (= H97), D126 (= D122), D126 (= D122), H128 (= H124), D130 (= D126), D234 (= D241), D234 (= D241), D236 (= D243)
7k4hA Human arginase 1 in complex with compound 04. (see paper)
38% identity, 67% coverage: 80:291/316 of query aligns to 83:281/318 of 7k4hA
- binding manganese (ii) ion: H100 (= H97), D123 (= D122), D123 (= D122), H125 (= H124), D127 (= D126), D231 (= D241), D231 (= D241), D233 (= D243)
- binding 3-[(1~{R},5~{S},8~{R})-5-carboxy-2,6-diazabicyclo[3.2.1]octan-8-yl]propyl-$l^{3}-oxidanyl-bis(oxidanyl)boranuide: D123 (= D122), H125 (= H124), D127 (= D126), S136 (= S135), H140 (= H139), G141 (= G140), D180 (= D192), D182 (≠ E194), D231 (= D241), D233 (= D243), T245 (= T255), E276 (= E286)
6v7fA Human arginase1 complexed with bicyclic inhibitor compound 13 (see paper)
38% identity, 67% coverage: 80:291/316 of query aligns to 83:281/318 of 6v7fA
- active site: H100 (= H97), D123 (= D122), H125 (= H124), D127 (= D126), H140 (= H139), D231 (= D241), D233 (= D243), E276 (= E286)
- binding manganese (ii) ion: H100 (= H97), D123 (= D122), D123 (= D122), H125 (= H124), D127 (= D126), D231 (= D241), D231 (= D241), D233 (= D243)
- binding {3-[(5R,7S,8S)-8-azaniumyl-8-carboxy-2-azaspiro[4.4]nonan-2-ium-7-yl]propyl}(trihydroxy)borate(1-): D123 (= D122), H125 (= H124), D127 (= D126), N129 (≠ H128), S136 (= S135), H140 (= H139), G141 (= G140), D182 (≠ E194), D231 (= D241), T245 (= T255), E276 (= E286)
6v7dA Human arginase1 complexed with bicyclic inhibitor compound 10 (see paper)
38% identity, 67% coverage: 80:291/316 of query aligns to 83:281/318 of 6v7dA
- active site: H100 (= H97), D123 (= D122), H125 (= H124), D127 (= D126), H140 (= H139), D231 (= D241), D233 (= D243), E276 (= E286)
- binding manganese (ii) ion: H100 (= H97), D123 (= D122), D123 (= D122), H125 (= H124), D127 (= D126), D231 (= D241), D231 (= D241), D233 (= D243)
- binding {3-[(3aR,4R,5S,6aR)-4-azaniumyl-4-carboxyoctahydrocyclopenta[b]pyrrol-1-ium-5-yl]propyl}(trihydroxy)borate(1-): D123 (= D122), H125 (= H124), D127 (= D126), S136 (= S135), H140 (= H139), D182 (≠ E194), D231 (= D241), T245 (= T255)
6qafA Crystal structure of human arginase-1 at ph 9.0 in complex with cb- 1158/incb001158 (see paper)
38% identity, 67% coverage: 80:291/316 of query aligns to 83:281/318 of 6qafA
- binding manganese (ii) ion: H100 (= H97), D123 (= D122), D123 (= D122), H125 (= H124), D127 (= D126), D231 (= D241), D231 (= D241), D233 (= D243)
- binding sodium ion: D231 (= D241), D233 (= D243), E276 (= E286)
- binding [(~{E})-3-[(3~{S},4~{R})-4-azanyl-1-[(2~{S})-2-azanylpropanoyl]-4-carboxy-pyrrolidin-3-yl]prop-1-enyl]-tris(oxidanyl)boranium: D123 (= D122), H125 (= H124), D127 (= D126), N129 (≠ H128), S136 (= S135), H140 (= H139), D182 (≠ E194), D231 (= D241)
6q92A Crystal structure of human arginase-1 at ph 7.0 in complex with abh (see paper)
38% identity, 67% coverage: 80:291/316 of query aligns to 83:281/318 of 6q92A
- binding 2(s)-amino-6-boronohexanoic acid: D123 (= D122), H125 (= H124), D127 (= D126), S136 (= S135), H140 (= H139), D182 (≠ E194), D231 (= D241), D233 (= D243)
- binding manganese (ii) ion: H100 (= H97), D123 (= D122), D123 (= D122), H125 (= H124), D127 (= D126), D231 (= D241), D231 (= D241), D233 (= D243)
- binding sodium ion: D231 (= D241), D233 (= D243), E276 (= E286)
7k4gE Human arginase 1 in complex with compound 01. (see paper)
38% identity, 67% coverage: 80:291/316 of query aligns to 83:281/319 of 7k4gE
- binding manganese (ii) ion: H100 (= H97), D123 (= D122), D123 (= D122), H125 (= H124), D127 (= D126), D231 (= D241), D231 (= D241), D233 (= D243)
- binding 3-[(2~{S},3~{R})-2-carboxypyrrolidin-3-yl]propyl-$l^{3}-oxidanyl-bis(oxidanyl)boranuide: D123 (= D122), H125 (= H124), D127 (= D126), S136 (= S135), H140 (= H139), G141 (= G140), D182 (≠ E194), D231 (= D241), T245 (= T255), E276 (= E286)
4gszA Crystal structure of the zn2+5-human arginase i-abh complex (see paper)
38% identity, 67% coverage: 80:291/316 of query aligns to 80:278/313 of 4gszA
- active site: H97 (= H97), D120 (= D122), H122 (= H124), D124 (= D126), H137 (= H139), D228 (= D241), D230 (= D243), E273 (= E286)
- binding 2(s)-amino-6-boronohexanoic acid: D120 (= D122), H122 (= H124), D124 (= D126), S133 (= S135), H137 (= H139), G138 (= G140), D179 (≠ E194), D228 (= D241), T242 (= T255)
- binding zinc ion: H97 (= H97), H111 (≠ N111), D113 (≠ E113), D120 (= D122), D120 (= D122), H122 (= H124), D124 (= D126), H137 (= H139), D228 (= D241), D228 (= D241), D230 (= D243), E273 (= E286)
8aupA Structure of harg1 with a novel inhibitor. (see paper)
38% identity, 67% coverage: 80:291/316 of query aligns to 83:281/316 of 8aupA
- binding manganese (ii) ion: H100 (= H97), D123 (= D122), D123 (= D122), H125 (= H124), D127 (= D126), D231 (= D241), D231 (= D241), D233 (= D243)
- binding 2-[(1~{R},3~{R},4~{S})-3-azanyl-3-carboxy-4-[(dimethylamino)methyl]cyclohexyl]ethyl-$l^{3}-oxidanyl-bis(oxidanyl)boron: D123 (= D122), H125 (= H124), D127 (= D126), S136 (= S135), H140 (= H139), D182 (≠ E194), D231 (= D241), D233 (= D243), T245 (= T255)
8e5nA Structure of arg1 complex with pyrrolidine-based non-boronic acid inhibitor 10 (see paper)
38% identity, 67% coverage: 80:291/316 of query aligns to 82:280/317 of 8e5nA
- binding manganese (ii) ion: H99 (= H97), D122 (= D122), D122 (= D122), H124 (= H124), D126 (= D126), D230 (= D241), D230 (= D241), D232 (= D243)
- binding 1-{[(3S,4S)-3-(3-fluorophenyl)-4-{[4-(1,3,4-triethyl-1H-pyrazol-5-yl)piperidin-1-yl]methyl}pyrrolidin-1-yl]methyl}cyclopentane-1-carboxylic acid: H124 (= H124), D126 (= D126), S135 (= S135), H139 (= H139), G140 (= G140), D179 (= D192), D181 (≠ E194), T244 (= T255)
Query Sequence
>Echvi_2468 FitnessBrowser__Cola:Echvi_2468
MRNIKLVEVRSELAAGTRGASLGIDALKVASLGKKSDFFTRFDPINVPDANNYLWKNNPY
PHAKYIDGVHEVLGNVHDTIKALREEKKFPIVLAGDHSTAAGTIMGIKAANPEKRLGVIW
IDAHADIHSPYTSPSGNMHGMPLGMCLQEDNLENRQQDPSAEEIEYWEKIKKIGGDFPKI
KASDIVYIAVRDTEEPENKLIEKHGIRNFTTQEVRQKGITQISEEALAILKDCEQIYISF
DVDSMDSSISVGTGTPVPDGLTVQEALKLNMELIKDKRVCCWEIVEVNPTLDSENIMAQN
AFEVLESTTKSLVSNF
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory