Comparing Echvi_2850 FitnessBrowser__Cola:Echvi_2850 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1wzaA Crystal structure of alpha-amylase from h.Orenii (see paper)
43% identity, 93% coverage: 38:519/519 of query aligns to 5:487/488 of 1wzaA
7jjnA Eubacterium rectale amy13b (eur_01860)
34% identity, 92% coverage: 40:517/519 of query aligns to 25:509/514 of 7jjnA
5m99A Functional characterization and crystal structure of thermostable amylase from thermotoga petrophila, reveals high thermostability and an archaic form of dimerization (see paper)
35% identity, 84% coverage: 39:476/519 of query aligns to 7:453/506 of 5m99A
5x7uA Trehalose synthase from thermobaculum terrenum (see paper)
32% identity, 86% coverage: 34:479/519 of query aligns to 4:490/546 of 5x7uA
Sites not aligning to the query:
1lwjA Crystal structure of t. Maritima 4-alpha-glucanotransferase/acarbose complex (see paper)
34% identity, 86% coverage: 39:482/519 of query aligns to 2:426/441 of 1lwjA
1lwhA Crystal structure of t. Maritima 4-alpha-glucanotransferase (see paper)
34% identity, 86% coverage: 39:482/519 of query aligns to 2:426/441 of 1lwhA
5gtwA The n253r mutant structures of trehalose synthase from deinococcus radiodurans display two different active-site conformations
31% identity, 86% coverage: 34:481/519 of query aligns to 3:499/548 of 5gtwA
8ibkA Crystal structure of bacillus sp. Ahu2216 gh13_31 alpha-glucosidase e256q/n258g in complex with maltotriose (see paper)
32% identity, 89% coverage: 31:494/519 of query aligns to 1:517/546 of 8ibkA
Sites not aligning to the query:
2ze0A Alpha-glucosidase gsj (see paper)
31% identity, 87% coverage: 31:480/519 of query aligns to 1:485/531 of 2ze0A
7jjtA Ruminococcus bromii amylase amy5 (rbr_07800)
36% identity, 85% coverage: 41:479/519 of query aligns to 22:461/513 of 7jjtA
5ykbD The n253f mutant structure of trehalose synthase from deinococcus radiodurans reveals an open active-site conformation (see paper)
31% identity, 86% coverage: 34:481/519 of query aligns to 3:475/523 of 5ykbD
5do8B 1.8 angstrom crystal structure of listeria monocytogenes lmo0184 alpha-1,6-glucosidase (see paper)
30% identity, 86% coverage: 34:480/519 of query aligns to 4:509/553 of 5do8B
4lxfB Crystal structure of m. Tuberculosis tres (see paper)
30% identity, 90% coverage: 34:499/519 of query aligns to 32:518/546 of 4lxfB
3zo9A The structure of trehalose synthase (tres) of mycobacterium smegmatis (see paper)
29% identity, 89% coverage: 28:488/519 of query aligns to 1:508/549 of 3zo9A
3zoaA The structure of trehalose synthase (tres) of mycobacterium smegmatis in complex with acarbose (see paper)
29% identity, 88% coverage: 34:488/519 of query aligns to 6:507/548 of 3zoaA
Sites not aligning to the query:
5brpA Crystal structure of bacillus licheniformis trehalose-6-phosphate hydrolase (trea), mutant r201q, in complex with png (see paper)
32% identity, 90% coverage: 32:498/519 of query aligns to 1:525/555 of 5brpA
5jy7B Complex of mycobacterium smegmatis trehalose synthase with maltokinase (see paper)
29% identity, 85% coverage: 28:470/519 of query aligns to 13:500/571 of 5jy7B
3zoaB The structure of trehalose synthase (tres) of mycobacterium smegmatis in complex with acarbose (see paper)
29% identity, 85% coverage: 28:470/519 of query aligns to 13:500/571 of 3zoaB
Sites not aligning to the query:
A0R6E0 Trehalose synthase/amylase TreS; Maltose alpha-D-glucosyltransferase; MTase; EC 3.2.1.1; EC 5.4.99.16 from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see 2 papers)
29% identity, 85% coverage: 28:470/519 of query aligns to 29:516/593 of A0R6E0
4mazA The structure of mall mutant enzyme v200s from bacillus subtilus (see paper)
31% identity, 88% coverage: 33:487/519 of query aligns to 2:521/559 of 4mazA
>Echvi_2850 FitnessBrowser__Cola:Echvi_2850
MRNLLRSFTYCTLVLLTASCMQDANEELEVKNYWPEAGITYEIFIQSFYDTDGDGIGDIN
GVTKKLDHVQELGANAIWFMPLMPSPSYHKYDVTDYKAIHPDYGTMDDFKQMLDEAHKRD
IKVVIDMIINHTSDEHPWFQEAKKGRDNPYRDYYVWAQYDTIQDYLDKKVVTLDSDNIRQ
WHDPGQGDDYYYGFFTGDMPDLNFDNPKVREEIYEIGRYWLAEVGVDGFRLDAAKHIYPD
DRAADSHEFWEEFRAEMEKVKPDVYLVGEVYDMKEVVAPYLTGLRALFNFDFHYTLLEAY
KKEDGMLLAKKQHDILAFYNGITDDFIDATISSNHDQPRLLNELGKSKDKLKQAIAILMT
MPGAPYIYYGEEIGMLGKKPDPNIREPFLWDVAEQDEGRTKWITPAFSTDNTVTPLAIQK
EDADSYFNHYKRVIQLRNTHPALAIGSLELPAEKYPKAVMAYQRKTGEQELYVFHNLGKK
SVEIPLPQGFDREVYHLKGAKVNGDKIKLPAFSSIVLGK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory