Comparing Echvi_3063 FitnessBrowser__Cola:Echvi_3063 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2d2fA Crystal structure of atypical cytoplasmic abc-atpase sufc from thermus thermophilus hb8 (see paper)
55% identity, 98% coverage: 2:248/253 of query aligns to 3:245/246 of 2d2fA
Q8ILW0 Iron-sulfur cluster assembly protein SufC; PfSufC; EC 3.6.1.- from Plasmodium falciparum (isolate 3D7) (see paper)
49% identity, 95% coverage: 1:241/253 of query aligns to 99:341/347 of Q8ILW0
7qkrA Cryo-em structure of abc transporter ste6-2p from pichia pastoris with verapamil at 3.2 a resolution (see paper)
32% identity, 91% coverage: 2:232/253 of query aligns to 362:594/1199 of 7qkrA
Sites not aligning to the query:
3c4jA Abc protein artp in complex with atp-gamma-s
29% identity, 93% coverage: 1:235/253 of query aligns to 3:227/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
29% identity, 93% coverage: 1:235/253 of query aligns to 3:227/242 of 3c41J
2olkA Abc protein artp in complex with adp-beta-s
29% identity, 93% coverage: 1:235/253 of query aligns to 3:227/242 of 2olkA
2oljA Abc protein artp in complex with adp/mg2+
29% identity, 93% coverage: 1:235/253 of query aligns to 3:227/242 of 2oljA
A0R6H8 Mycobactin import ATP-binding/permease protein IrtA; EC 7.2.2.- from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see paper)
30% identity, 87% coverage: 15:235/253 of query aligns to 623:831/860 of A0R6H8
Sites not aligning to the query:
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
29% identity, 91% coverage: 1:231/253 of query aligns to 2:221/241 of 4u00A
P9WQJ9 Mycobactin import ATP-binding/permease protein IrtA; Iron-regulated transporter A; EC 7.2.2.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
28% identity, 87% coverage: 13:231/253 of query aligns to 622:828/859 of P9WQJ9
Sites not aligning to the query:
O65934 ABC transporter ATP-binding/permease protein Rv1747; EC 7.-.-.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 3 papers)
31% identity, 87% coverage: 2:222/253 of query aligns to 319:528/865 of O65934
Sites not aligning to the query:
1g9xB Characterization of the twinning structure of mj1267, an atp-binding cassette of an abc transporter (see paper)
28% identity, 85% coverage: 17:231/253 of query aligns to 20:235/253 of 1g9xB
Sites not aligning to the query:
7wixA Cryo-em structure of mycobacterium tuberculosis irtab in complex with adp (see paper)
28% identity, 87% coverage: 13:231/253 of query aligns to 347:553/571 of 7wixA
Sites not aligning to the query:
7wivA Cryo-em structure of mycobacterium tuberculosis irtab in complex with an amp-pnp (see paper)
28% identity, 87% coverage: 13:231/253 of query aligns to 347:553/571 of 7wivA
Sites not aligning to the query:
1g6hA Crystal structure of the adp conformation of mj1267, an atp-binding cassette of an abc transporter (see paper)
28% identity, 85% coverage: 17:231/253 of query aligns to 20:235/254 of 1g6hA
Sites not aligning to the query:
7wiwA Cryo-em structure of mycobacterium tuberculosis irtab complexed with atp in an occluded conformation (see paper)
27% identity, 87% coverage: 13:231/253 of query aligns to 347:553/570 of 7wiwA
Sites not aligning to the query:
P33310 ATP-dependent permease MDL1, mitochondrial; ABC transporter MDL1; Multidrug resistance-like protein 1 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
31% identity, 85% coverage: 16:229/253 of query aligns to 449:656/695 of P33310
Q9JI39 ATP-binding cassette sub-family B member 10, mitochondrial; ABC-mitochondrial erythroid protein; ABC-me protein; ATP-binding cassette transporter 10; ABC transporter 10 protein from Mus musculus (Mouse) (see 2 papers)
27% identity, 94% coverage: 2:240/253 of query aligns to 457:689/715 of Q9JI39
Sites not aligning to the query:
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
29% identity, 91% coverage: 1:231/253 of query aligns to 1:221/240 of 4ymuJ
4f4cA The crystal structure of the multi-drug transporter (see paper)
25% identity, 85% coverage: 16:229/253 of query aligns to 1038:1242/1250 of 4f4cA
Sites not aligning to the query:
>Echvi_3063 FitnessBrowser__Cola:Echvi_3063
MLSIKNLHASIEGTPILKGINLEIKPGEVHAIMGPNGSGKSTLASVLAGREEYEVTDGEV
TFNGKDLLEMNPEDRAREGVFLAFQYPVEIPGVSTTNFLRTAVNQVREYRGQEALDAVKF
LSLMKEKMKLVEIDQKLMSRALNEGFSGGEKKRNEIFQMAMLEPTLSILDETDSGLDIDA
LKIVSNGVNQLKSKDNATIVVTHYQRLLDYIVPDYVHVLYKGRIVKSGSKELALDLEENG
YDWIKADVDGASV
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory