SitesBLAST
Comparing Echvi_3106 FitnessBrowser__Cola:Echvi_3106 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 13 hits to proteins with known functional sites (download)
P0AA76 D-galactonate transporter; D-galactonate/H(+) symporter from Escherichia coli (strain K12) (see paper)
28% identity, 99% coverage: 2:437/441 of query aligns to 1:426/430 of P0AA76
- Y29 (= Y29) binding
- D31 (= D31) mutation to N: Loss of galactonate transport activity.
- R32 (= R32) binding
- Y64 (= Y80) binding
- E118 (= E134) mutation to Q: Loss of galactonate transport activity.
- W358 (≠ F369) binding
6e9nA E. Coli d-galactonate:proton symporter in the inward open form (see paper)
28% identity, 96% coverage: 14:437/441 of query aligns to 3:407/409 of 6e9nA
6e9oA E. Coli d-galactonate:proton symporter mutant e133q in the outward substrate-bound form (see paper)
27% identity, 96% coverage: 14:437/441 of query aligns to 6:391/393 of 6e9oA
Q8BN82 Sialin; H(+)/nitrate cotransporter; H(+)/sialic acid cotransporter; AST; Solute carrier family 17 member 5; Vesicular excitatory amino acid transporter; VEAT from Mus musculus (Mouse) (see paper)
25% identity, 63% coverage: 14:292/441 of query aligns to 39:335/495 of Q8BN82
- R39 (= R14) mutation to C: Completely abolishes L-aspartate and L-glutamate transporter activity. Retains appreciable H(+)-coupled sialic acid transporter activity.
- H183 (≠ I142) mutation to R: Abolishes sialic acid transporter activity. Does not affect L-aspartate and L-glutamate transporter activity.
Q03567 Uncharacterized transporter slc-17.2 from Caenorhabditis elegans (see paper)
24% identity, 90% coverage: 9:406/441 of query aligns to 10:422/493 of Q03567
- N69 (≠ S58) modified: carbohydrate, N-linked (GlcNAc...) asparagine
Q5Q0U0 Sialin; H(+)/nitrate cotransporter; H(+)/sialic acid cotransporter; AST; Solute carrier family 17 (Anion/sugar transporter), member 5; Vesicular excitatory amino acid transporter; VEAT from Rattus norvegicus (Rat) (see 2 papers)
25% identity, 63% coverage: 14:292/441 of query aligns to 39:335/495 of Q5Q0U0
- R39 (= R14) mutation to C: Markedly decreases H(+)-coupled sialic acid transporter activity.
- K136 (≠ R97) mutation to E: Markedly decreases H(+)-coupled sialic acid transporter activity.
- R168 (= R127) mutation to C: Abolishes H(+)-coupled sialic acid transporter activity.
- E171 (≠ F130) mutation to C: Decreases H(+)-coupled sialic acid transporter activity; when associated with C-175.
- G172 (= G131) mutation to C: Decreases protein levels and alters subcellular localization.
- E175 (= E134) mutation to C: Decreases H(+)-coupled sialic acid transporter activity; when associated with C-171.
- G176 (≠ S135) mutation to C: Decreases protein levels and alters subcellular localization.
- F179 (= F138) mutation to C: Decreases the affinity and transport rate for D-glucuronate. Does not affect H(+)-coupled sialic acid transporter activity.
- P180 (= P139) mutation to C: Decreases protein levels and alters subcellular localization.
- H183 (≠ I142) mutation to R: Abolishes H(+)-coupled sialic acid transporter activity.
- W186 (≠ I145) mutation to C: Abolishes H(+)-coupled sialic acid transporter activity.
- SSLKN 268:272 (≠ ADEES 226:230) mutation Missing: Abolishes H(+)-coupled sialic acid transporter activity.
- P334 (= P291) mutation to R: Abolishes H(+)-coupled sialic acid transporter activity.
Sites not aligning to the query:
- 22:23 Dileucine internalization motif; LL→AA: Targeted to plasma membrane; sialic acid uptake strongly activated at acidic pH.
- 371 G→V: Remains in the endoplasmic reticulum.
Q9NRA2 Sialin; H(+)/nitrate cotransporter; H(+)/sialic acid cotransporter; AST; Membrane glycoprotein HP59; Solute carrier family 17 member 5; Vesicular excitatory amino acid transporter; VEAT from Homo sapiens (Human) (see 8 papers)
25% identity, 63% coverage: 14:293/441 of query aligns to 39:336/495 of Q9NRA2
- R39 (= R14) to C: in SD; frequent variant in Finland; alters intracellular localization, only partially targeted to lysosomes and mainly detected in LAMP1-negative vesicles and in the Golgi apparatus; completely devoid of L-aspartate and L-glutamate transport activity, but retains appreciable H(+)-coupled sialic acid and nitrate transporter activity; dbSNP:rs80338794
- K136 (≠ R97) to E: in SD; alters intracellular localization, only partially targeted to lysosomes and mainly detected in LAMP1-negative vesicles and in the Golgi apparatus; completely devoid of L-aspartate and L-glutamate transporter activity, but retains appreciable H(+)-coupled sialic acid transporter activity; dbSNP:rs80338795
- H183 (≠ I142) to R: in ISSD; alters intracellular localization, only partially targeted to lysosomes and mainly detected in LAMP1-negative vesicles and in the Golgi apparatus; abolishes H(+)-coupled sialic acid transporter activity; has normal L-aspartate and L-glutamate transporter activity; dbSNP:rs119491109
- LL 198:199 (≠ AT 157:158) mutation to AA: Localizes in vesicular structures mainly concentrated in the perinuclear region.
- IL 266:267 (≠ IH 224:225) mutation to LA: Localizes in vesicular structures mainly concentrated in the perinuclear region.
- SSLRN 268:272 (≠ ADEES 226:230) natural variant: Missing (in ISSD; alters intracellular localization, only partially targeted to lysosomes and mainly detected in LAMP1-negative vesicles and in the Golgi apparatus; abolishes H(+)-coupled sialic acid transporter activity; has normal L-aspartate and L-glutamate transporter activity)
- G328 (= G287) to E: in ISSD; some patients may manifest a milder phenotype consistent with Salla disease; markedly decreases H(+)-coupled sialic acid transporter activity; abolishes L-aspartate and L-glutamate transporter activity; dbSNP:rs386833996
- P334 (= P291) to R: in ISSD; does not affect intracellular localization, targeted to lysosomes; abolishes H(+)-coupled sialic acid transporter activity; abolishes L-aspartate and L-glutamate transporter activity; dbSNP:rs119491110
Sites not aligning to the query:
- 22:23 Dileucine internalization motif; LL→AA: Targeted to plasma membrane.; LL→GG: Targeted to plasma membrane; sialic acid uptake strongly activated at acidic pH.
- 371 G → V: in ISSD; abolishes H(+)-coupled sialic acid transporter activity; abolishes L-aspartate and L-glutamate transporter activity; dbSNP:rs777862172
Q9JI12 Vesicular glutamate transporter 2; VGluT2; Differentiation-associated BNPI; Differentiation-associated Na(+)-dependent inorganic phosphate cotransporter; Solute carrier family 17 member 6 from Rattus norvegicus (Rat) (see 2 papers)
25% identity, 80% coverage: 69:420/441 of query aligns to 124:484/582 of Q9JI12
- H128 (≠ D73) mutation to A: Greatly lowers L-glutamate transport.
- R184 (= R127) mutation R->A,E,K: Greatly lowers L-glutamate transport.
- E191 (= E134) mutation to A: Greatly lowers L-glutamate transport.; mutation E->D,Q: Lowers L-glutamate transport.
- R322 (≠ T258) mutation to A: Loss of L-glutamate release. Abolishes the chloride ion conductance.
Sites not aligning to the query:
- 88 R→A: Impairs synaptic transmission. Abolishes the chloride ion conductance.
7t3nA R184q/e191q mutant of rat vesicular glutamate transporter 2 (vglut2)
24% identity, 80% coverage: 69:420/441 of query aligns to 66:426/452 of 7t3nA
Sites not aligning to the query:
Q8NLB7 Gentisate transporter from Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) (see paper)
25% identity, 77% coverage: 69:407/441 of query aligns to 79:400/444 of Q8NLB7
- R103 (= R93) mutation to A: Loss of transport activity.
- W309 (= W308) mutation to V: Loss of transport activity.
- D312 (≠ G311) mutation to A: Loss of transport activity.
- R313 (≠ K312) mutation to A: Loss of transport activity.
- I317 (≠ M316) mutation I->H,Y: Loss of transport activity.
- R386 (≠ G393) mutation to A: Loss of transport activity.
Sites not aligning to the query:
- 54 D→A: Loss of transport activity.; D→E: Retains 50% of its transport activity.
- 57 D→A: Loss of transport activity.; D→E: Retains 50% of its transport activity.
Q9Y2C5 Probable small intestine urate exporter; Solute carrier family 17 member 4 from Homo sapiens (Human) (see 2 papers)
27% identity, 54% coverage: 57:293/441 of query aligns to 114:339/497 of Q9Y2C5
Sites not aligning to the query:
- 66 modified: carbohydrate, N-linked (GlcNAc...) asparagine; N→A: Loss of glycosylation and significant reduction in the transport of thyroid hormones T3 and T4; when associated with A-75 and A-90.
- 75 modified: carbohydrate, N-linked (GlcNAc...) asparagine; N→A: Loss of glycosylation and significant reduction in the transport of thyroid hormones T3 and T4; when associated with A-66 and A-90.
- 90 modified: carbohydrate, N-linked (GlcNAc...) asparagine; N→A: Loss of glycosylation and significant reduction in the transport of thyroid hormones T3 and T4; when associated with A-75 and A-90.
- 372 A → T: in dbSNP:rs11754288
Q51955 4-hydroxybenzoate transporter PcaK from Pseudomonas putida (Arthrobacter siderocapsulatus) (see 2 papers)
23% identity, 91% coverage: 13:412/441 of query aligns to 26:416/448 of Q51955
- D41 (≠ K28) mutation D->A,N: Abolishes 4-HBA transport.; mutation to E: Decrease in 4-HBA transport.
- D44 (= D31) mutation D->A,N: Abolishes 4-HBA transport.; mutation to E: Decrease in 4-HBA transport.
- G85 (≠ V72) mutation to V: Abolishes 4-HBA transport and chemotaxis.
- D89 (≠ F76) mutation to N: Abolishes 4-HBA transport and chemotaxis.
- G92 (≠ A79) mutation to A: Decrease in 4-HBA transport and chemotaxis.; mutation to C: No change in 4-HBA transport and chemotaxis.; mutation G->L,V: Abolishes 4-HBA transport and chemotaxis.; mutation to Q: Decrease in 4-HBA transport and strong decrease in chemotaxis.
- R124 (= R127) mutation to A: Abolishes 4-HBA transport.
- E144 (= E147) mutation to A: Strong decrease in 4-HBA transport.
- H183 (≠ R186) mutation to A: Decrease in 4-HBA transport and chemotaxis.
- D323 (≠ G311) mutation to N: Abolishes 4-HBA transport and chemotaxis.
- H328 (≠ S323) mutation to A: Decrease in 4-HBA transport and chemotaxis.; mutation to R: Decrease in 4-HBA transport and loss of chemotaxis.
- R386 (≠ S383) mutation to A: Strong decrease in 4-HBA transport.
- R398 (≠ I394) mutation to A: Abolishes 4-HBA transport.
Sites not aligning to the query:
- 444 H→A: No change in 4-HBA transport and chemotaxis.
Q9GQQ0 Protein spinster; Protein benchwarmer; Protein diphthong from Drosophila melanogaster (Fruit fly) (see paper)
22% identity, 55% coverage: 1:244/441 of query aligns to 101:314/605 of Q9GQQ0
- E217 (= E134) mutation to K: In bnch(N); leads to storage in yolk spheres during oogenesis and results in widespread accumulation of enlarged lysosomal and late endosomal inclusions.
Query Sequence
>Echvi_3106 FitnessBrowser__Cola:Echvi_3106
MVKIKLNSIIKGYRWRIVALLFLATAIKYIDRNVLSFTMIDEGFRREMLGVSDTTALSSE
LIGKFKILMGYVDASFKFAYAIGFVLMGYFIDRVLVRKGYSIAIAIWSLAGIVTAFVSSF
RGLSFTRFVFGFGESANFPAAIKTIAEWFPKKERSFATGIYNAGANVGIMATVLIVPALI
LNLGWRWSFLCTGLLGLVLLACWLLIYKPPKAHPKVSQDEQEHIHADEESEHEAEKVPWK
DLLKTKGAWAIALGKFLTDPIWWFYLTWLPDFFNSNEALETKLDLTGLALPFIFIYFTSD
LGSVFFGWLSGKFINMGWSLNKSRKVTLLLCALLVVPLIFAAKVANVYVAMVLVALAAAA
HQGWSANLFTLSSDIFPKRVVGSVVGLAGMVGGIGGTIFAAFAGIILVKWGYFPIFIIAS
SAYLLAWLIIHLLVPKIGVRS
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory