Comparing Echvi_3112 FitnessBrowser__Cola:Echvi_3112 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P07821 Iron(3+)-hydroxamate import ATP-binding protein FhuC; Ferric hydroxamate uptake protein C; Ferrichrome transport ATP-binding protein FhuC; Iron(III)-hydroxamate import ATP-binding protein FhuC; EC 7.2.2.16 from Escherichia coli (strain K12) (see 2 papers)
34% identity, 91% coverage: 7:252/271 of query aligns to 16:261/265 of P07821
1l7vC Bacterial abc transporter involved in b12 uptake (see paper)
34% identity, 79% coverage: 24:237/271 of query aligns to 21:230/231 of 1l7vC
4fi3C Structure of vitamin b12 transporter btucd-f in a nucleotide-bound state (see paper)
33% identity, 79% coverage: 24:237/271 of query aligns to 21:230/248 of 4fi3C
Sites not aligning to the query:
P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
31% identity, 87% coverage: 2:237/271 of query aligns to 17:246/378 of P69874
Sites not aligning to the query:
5x40A Structure of a cbio dimer bound with amppcp (see paper)
33% identity, 78% coverage: 18:228/271 of query aligns to 21:229/280 of 5x40A
Sites not aligning to the query:
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
27% identity, 85% coverage: 2:231/271 of query aligns to 2:228/241 of 4u00A
7wixB Cryo-em structure of mycobacterium tuberculosis irtab in complex with adp
32% identity, 79% coverage: 16:229/271 of query aligns to 344:554/576 of 7wixB
6mjpA Lptb(e163q)fgc from vibrio cholerae (see paper)
26% identity, 87% coverage: 2:236/271 of query aligns to 2:233/240 of 6mjpA
P19566 Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
32% identity, 74% coverage: 21:221/271 of query aligns to 22:216/369 of P19566
Sites not aligning to the query:
7wiwB Cryo-em structure of mycobacterium tuberculosis irtab complexed with atp in an occluded conformation
32% identity, 79% coverage: 16:229/271 of query aligns to 347:557/567 of 7wiwB
Sites not aligning to the query:
Q9LVM1 ABC transporter B family member 25, mitochondrial; ABC transporter ABCB.25; AtABCB25; ABC transporter of the mitochondrion 3; AtATM3; Iron-sulfur clusters transporter ATM3; Protein STARIK 1 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
32% identity, 81% coverage: 3:222/271 of query aligns to 479:696/728 of Q9LVM1
7n59A Structure of atatm3 in the inward-facing conformation with gssg bound (see paper)
32% identity, 81% coverage: 3:222/271 of query aligns to 353:570/590 of 7n59A
Sites not aligning to the query:
7n5aA Structure of atatm3 in the closed conformation (see paper)
32% identity, 81% coverage: 3:222/271 of query aligns to 352:569/589 of 7n5aA
8iddA Cryo-em structure of mycobacterium tuberculosis atp bound ftsex/ripc complex in peptidisc (see paper)
28% identity, 80% coverage: 1:218/271 of query aligns to 1:218/225 of 8iddA
8igqA Cryo-em structure of mycobacterium tuberculosis adp bound ftsex/ripc complex in peptidisc (see paper)
28% identity, 80% coverage: 1:218/271 of query aligns to 1:218/227 of 8igqA
8g4cB Bceabs atpgs high res tm (see paper)
31% identity, 76% coverage: 12:217/271 of query aligns to 17:221/248 of 8g4cB
Sites not aligning to the query:
6tejB Structure of apo irtab devoid sid in complex with sybody syb_nl5 (see paper)
31% identity, 84% coverage: 3:229/271 of query aligns to 331:554/585 of 6tejB
A5U7B7 Cell division ATP-binding protein FtsE from Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) (see 2 papers)
28% identity, 75% coverage: 15:218/271 of query aligns to 16:217/229 of A5U7B7
7tchB Bceab e169q variant atp-bound conformation (see paper)
31% identity, 76% coverage: 12:217/271 of query aligns to 16:220/245 of 7tchB
Sites not aligning to the query:
3nhaA Nucleotide binding domain of human abcb6 (adp mg bound structure) (see paper)
30% identity, 83% coverage: 3:228/271 of query aligns to 41:263/278 of 3nhaA
>Echvi_3112 FitnessBrowser__Cola:Echvi_3112
MMISAENIHFCIQKRPILDQVDLQIYPGEVLTILGPNGAGKSTLLKLLSGENTCDTGKIS
INQVLLQQLKPRQLAKYRAVMPQHSSVNFPYTVEEIIALGKLAHDPHSSSDQLMEEVMDI
TGTAALRERMIKGLSGGERQRVHLARALLQIWEDKPYARYLLLDEPTSSMDIAQQHQVLR
LLRFLRQRNIGVLTILHDLNLAAQYSDKVMLMKDGKVVGFGPTSAIMTATKLSHVYGHPI
SVMSHPMDEKQVVITSETTSNNHTYASFKTA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory