Comparing Echvi_4177 FitnessBrowser__Cola:Echvi_4177 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q3L181 Perakine reductase; EC 1.1.1.317 from Rauvolfia serpentina (Serpentine wood) (Ophioxylon serpentinum) (see paper)
44% identity, 96% coverage: 1:315/327 of query aligns to 1:317/337 of Q3L181
3v0sA Crystal structure of perakine reductase, founder member of a novel akr subfamily with unique conformational changes during NADPH binding (see paper)
42% identity, 94% coverage: 1:307/327 of query aligns to 1:277/287 of 3v0sA
P46336 Aldo-keto reductase IolS; AKR11A; Vegetative protein 147; VEG147; EC 1.1.1.- from Bacillus subtilis (strain 168) (see paper)
34% identity, 92% coverage: 1:300/327 of query aligns to 1:302/310 of P46336
1pz0A Structure of NADPH-dependent family 11 aldo-keto reductase akr11a(holo) (see paper)
34% identity, 91% coverage: 2:300/327 of query aligns to 1:301/311 of 1pz0A
P80874 Aldo-keto reductase YhdN; AKR11B; General stress protein 69; GSP69; EC 1.1.1.- from Bacillus subtilis (strain 168) (see paper)
32% identity, 94% coverage: 1:309/327 of query aligns to 1:312/331 of P80874
1pz1A Structure of NADPH-dependent family 11 aldo-keto reductase akr11b(holo) (see paper)
32% identity, 94% coverage: 1:309/327 of query aligns to 1:312/333 of 1pz1A
8hnqA The structure of a alcohol dehydrogenase akr13b2 with NADP
33% identity, 90% coverage: 11:303/327 of query aligns to 23:285/286 of 8hnqA
6ow0A Crystal structure of mithramycin 3-side chain keto-reductase mtmw in complex with NAD+ and peg (see paper)
32% identity, 94% coverage: 1:309/327 of query aligns to 1:318/323 of 6ow0A
6ow0B Crystal structure of mithramycin 3-side chain keto-reductase mtmw in complex with NAD+ and peg (see paper)
32% identity, 94% coverage: 1:309/327 of query aligns to 1:294/301 of 6ow0B
Q9P7U2 Putative aryl-alcohol dehydrogenase C977.14c; EC 1.1.1.- from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
32% identity, 91% coverage: 5:300/327 of query aligns to 11:335/351 of Q9P7U2
P77256 NADH-specific methylglyoxal reductase; AKR11B2; EC 1.1.1.- from Escherichia coli (strain K12) (see paper)
31% identity, 91% coverage: 1:299/327 of query aligns to 1:313/326 of P77256
4aubB The complex structure of the bacterial aldo-keto reductase akr14a1 with NADP and citrate (see paper)
31% identity, 95% coverage: 1:312/327 of query aligns to 11:326/335 of 4aubB
Sites not aligning to the query:
8hw0A The structure of akr6d1
31% identity, 89% coverage: 1:290/327 of query aligns to 1:300/329 of 8hw0A
P63144 Voltage-gated potassium channel subunit beta-1; K(+) channel subunit beta-1; Kv-beta-1; EC 1.1.1.- from Rattus norvegicus (Rat) (see paper)
30% identity, 94% coverage: 1:309/327 of query aligns to 71:391/401 of P63144
Q14722 Voltage-gated potassium channel subunit beta-1; K(+) channel subunit beta-1; Kv-beta-1; EC 1.1.1.- from Homo sapiens (Human) (see paper)
30% identity, 94% coverage: 1:309/327 of query aligns to 89:409/419 of Q14722
O14295 Pyridoxal reductase; PL reductase; PL-red; EC 1.1.1.65 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
31% identity, 95% coverage: 9:318/327 of query aligns to 5:324/333 of O14295
6hg6A Clostridium beijerinckii aldo-keto reductase cbei_3974 with NADPH (see paper)
30% identity, 93% coverage: 1:303/327 of query aligns to 12:307/313 of 6hg6A
7wf3C Composite map of human kv1.3 channel in apo state with beta subunits (see paper)
30% identity, 94% coverage: 4:309/327 of query aligns to 7:324/328 of 7wf3C
3n6qD Crystal structure of yghz from e. Coli (see paper)
30% identity, 95% coverage: 1:312/327 of query aligns to 12:313/315 of 3n6qD
Q13303 Voltage-gated potassium channel subunit beta-2; K(+) channel subunit beta-2; Kv-beta-2; hKvbeta2; EC 1.1.1.- from Homo sapiens (Human) (see 2 papers)
30% identity, 94% coverage: 4:309/327 of query aligns to 40:357/367 of Q13303
Sites not aligning to the query:
>Echvi_4177 FitnessBrowser__Cola:Echvi_4177
MEKRTLGNQGLKVSALGLGCMGLSFGYGPPTEKNAAIKLIRSAFEQGITFFDTAECYGPF
TNEELVGEAIAPFRKEVVIATKFGFKDGDSKKGLDSSPKRIREVAESSLRRLNTDHIDLF
YQHRVDPSVPMEDVAGTMSDLIKEGKIGHWGLSEAGATTIRKAHAIQPLAALQSEYSLFY
REPEKEIIPLLEEFGIGFVPFSPLGKGFLTGAISESTQFDPNDFRNTVPRFSKENRKANQ
ALVDLVKKIAVQKQATPGQIALGWLLAQKPFILPIPGTTKQHRLTENVGSTKINLSDDDL
FQVSTALKNIQLVGERYSAAAQKMIDR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory