Comparing Echvi_4213 FitnessBrowser__Cola:Echvi_4213 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 7 hits to proteins with known functional sites (download)
P0A7B5 Glutamate 5-kinase; Gamma-glutamyl kinase; GK; EC 2.7.2.11 from Escherichia coli (strain K12) (see paper)
32% identity, 95% coverage: 9:258/263 of query aligns to 5:253/367 of P0A7B5
2j5tD Glutamate 5-kinase from escherichia coli complexed with glutamate (see paper)
31% identity, 95% coverage: 9:258/263 of query aligns to 3:251/365 of 2j5tD
Sites not aligning to the query:
7wx3B Gk domain of drosophila p5cs filament with glutamate, atp, and NADPH (see paper)
32% identity, 96% coverage: 6:258/263 of query aligns to 10:254/258 of 7wx3B
7f5xA Gk domain of drosophila p5cs filament with glutamate (see paper)
32% identity, 96% coverage: 6:258/263 of query aligns to 10:232/236 of 7f5xA
2akoA Crystal structure of glutamate 5-kinase from campylobacter jejuni
31% identity, 95% coverage: 9:257/263 of query aligns to 1:236/241 of 2akoA
2j5vB Glutamate 5-kinase from escherichia coli complexed with glutamyl-5- phosphate and pyroglutamic acid (see paper)
28% identity, 95% coverage: 9:258/263 of query aligns to 3:211/325 of 2j5vB
2j5vA Glutamate 5-kinase from escherichia coli complexed with glutamyl-5- phosphate and pyroglutamic acid (see paper)
28% identity, 95% coverage: 9:258/263 of query aligns to 3:209/323 of 2j5vA
>Echvi_4213 FitnessBrowser__Cola:Echvi_4213
MENLSKKPRKIVVKVGSNMLTNHKNRIMDTVLQHLVGQLAELYEDNIMPILITSGSVAAG
MEAMGRELSIKDDAVRRQIYSSMGQPRLMRHYYEIFQQYGIRCGQVLATKRDFSPGKHRE
NMINCYNGLIASGIVPIANEDDTVSLSMSAFSDNDELAALVAELLEADMLIFLTHKDGVF
NGPPDAAHTEVLEEVKIDEKTEQYIHDKGDPKTIGRGNMASKLKMAKKAASKNIAVHIAN
GTTPNVLLDIVNGKQIGTRVMAN
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory