Comparing Echvi_4304 FitnessBrowser__Cola:Echvi_4304 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2xuaH Crystal structure of the enol-lactonase from burkholderia xenovorans lb400 (see paper)
36% identity, 95% coverage: 12:268/270 of query aligns to 3:260/261 of 2xuaH
6eb3B Structural and enzymatic characterization of an esterase from a metagenomic library
28% identity, 87% coverage: 12:245/270 of query aligns to 3:240/268 of 6eb3B
6eb3A Structural and enzymatic characterization of an esterase from a metagenomic library
28% identity, 87% coverage: 12:245/270 of query aligns to 3:237/265 of 6eb3A
6eb3C Structural and enzymatic characterization of an esterase from a metagenomic library
36% identity, 44% coverage: 12:131/270 of query aligns to 3:121/262 of 6eb3C
4uhdA Structural studies of a thermophilic esterase from thermogutta terrifontis (acetate bound) (see paper)
27% identity, 96% coverage: 10:267/270 of query aligns to 5:267/274 of 4uhdA
4uheA Structural studies of a thermophilic esterase from thermogutta terrifontis (malate bound) (see paper)
27% identity, 96% coverage: 10:267/270 of query aligns to 5:267/272 of 4uheA
4uhfA Structural studies of a thermophilic esterase from thermogutta terrifontis (l37a mutant with butyrate bound) (see paper)
27% identity, 96% coverage: 10:267/270 of query aligns to 5:267/278 of 4uhfA
3heaA The l29p/l124i mutation of pseudomonas fluorescens esterase (see paper)
28% identity, 86% coverage: 12:244/270 of query aligns to 3:245/271 of 3heaA
Sites not aligning to the query:
3hi4A Switching catalysis from hydrolysis to perhydrolysis in p. Fluorescens esterase (see paper)
28% identity, 86% coverage: 12:244/270 of query aligns to 3:245/271 of 3hi4A
Sites not aligning to the query:
3ia2A Pseudomonas fluorescens esterase complexed to the r-enantiomer of a sulfonate transition state analog (see paper)
28% identity, 86% coverage: 12:244/270 of query aligns to 3:245/271 of 3ia2A
Sites not aligning to the query:
P22862 Arylesterase; Aryl-ester hydrolase; Carboxylic acid perhydrolase; PFE; Putative bromoperoxidase; EC 3.1.1.2; EC 1.-.-.- from Pseudomonas fluorescens (see 5 papers)
28% identity, 86% coverage: 12:244/270 of query aligns to 4:246/272 of P22862
Sites not aligning to the query:
8pi1B Bicyclic incypro pseudomonas fluorescens esterase (see paper)
28% identity, 86% coverage: 12:244/270 of query aligns to 3:245/276 of 8pi1B
Sites not aligning to the query:
1iunB Meta-cleavage product hydrolase from pseudomonas fluorescens ip01 (cumd) s103a mutant hexagonal (see paper)
26% identity, 89% coverage: 30:268/270 of query aligns to 25:270/276 of 1iunB
2d0dA Crystal structure of a meta-cleavage product hydrolase (cumd) a129v mutant (see paper)
26% identity, 89% coverage: 30:268/270 of query aligns to 24:269/271 of 2d0dA
1ukaA Crystal structure of a meta-cleavage product hydrolase (cumd) complexed with (s)-2-methylbutyrate (see paper)
26% identity, 89% coverage: 30:268/270 of query aligns to 24:269/271 of 1ukaA
1uk9A Crystal structure of a meta-cleavage product hydrolase (cumd) complexed with isovalerate (see paper)
26% identity, 89% coverage: 30:268/270 of query aligns to 24:269/271 of 1uk9A
1uk8A Crystal structure of a meta-cleavage product hydrolase (cumd) complexed with n-valerate (see paper)
26% identity, 89% coverage: 30:268/270 of query aligns to 24:269/271 of 1uk8A
1uk7A Crystal structure of a meta-cleavage product hydrolase (cumd) complexed with n-butyrate (see paper)
26% identity, 89% coverage: 30:268/270 of query aligns to 24:269/271 of 1uk7A
1iupA Meta-cleavage product hydrolase from pseudomonas fluorescens ip01 (cumd) s103a mutant complexed with isobutyrates (see paper)
26% identity, 89% coverage: 30:268/270 of query aligns to 24:269/271 of 1iupA
1ek1A Crystal structure of murine soluble epoxide hydrolase complexed with ciu inhibitor (see paper)
27% identity, 49% coverage: 5:136/270 of query aligns to 179:310/490 of 1ek1A
Sites not aligning to the query:
>Echvi_4304 FitnessBrowser__Cola:Echvi_4304
MVKKNGLDRKYFTTQDGCEIVYKIDGEVTNPVLVLSNSIATDLAMWDGQVEAFCKSYRLL
RFDTRGHGLSESPVGDYSVARLAKDVIELMDYLGIEKAHFCGLSLGGFIGQWLGVHVPHR
LDKLILANTSPYLGPDTIWNENIHLLRNGSDMSHFEELFINGWFPKQMINNQKNRVVPFR
KMILSTSPIGLAGAYAAVRDADFRKTNALIPNKTLILAGEHDQVTKPEHSKLMHEVIRGA
TLKVLPVVHLSNIERINEFERLVLQFLSSP
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory