SitesBLAST
Comparing Echvi_4409 FitnessBrowser__Cola:Echvi_4409 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q7BJX9 UDP-N-acetylglucosamine 4-epimerase; UDP-GalNAc 4-epimerase; EC 5.1.3.7 from Plesiomonas shigelloides (Aeromonas shigelloides) (see 2 papers)
52% identity, 92% coverage: 16:348/362 of query aligns to 23:339/345 of Q7BJX9
- GVAGFI 26:31 (≠ GGAGFI 19:24) binding
- DNFSTG 50:55 (= DNFSTG 43:48) binding
- DI 81:82 (= DI 68:69) binding
- QAA 101:103 (= QAA 88:90) binding
- T120 (≠ V107) binding
- SS 145:146 (= SS 132:133) binding
- S147 (= S134) mutation to T: No effect on epimerase activity.
- Y169 (= Y156) binding
- K173 (= K160) binding
- YFN 196:198 (= YFN 183:185) binding
- V199 (= V186) binding
- VIPK 213:216 (= VIPK 200:203) binding
- YIN 228:230 (≠ RIN 215:217) binding
- S236 (= S223) mutation to G: No effect on epimerase activity.
- R237 (= R224) binding
- R271 (= R279) mutation to G: No effect on epimerase activity.
- RSGD 302:305 (≠ RAGD 311:314) binding
- R307 (≠ P316) mutation to A: No effect on epimerase activity.
- H308 (= H317) mutation to A: No effect on epimerase activity.
- S309 (= S318) mutation to Y: Abolishes epimerase activity.
3ruhA Alternative analogs as viable substrates of udp-hexose 4-epimerases
52% identity, 92% coverage: 16:348/362 of query aligns to 20:331/336 of 3ruhA
- active site: S142 (= S132), S143 (= S133), S144 (= S134), Y166 (= Y156), K170 (= K160), N204 (≠ D194)
- binding nicotinamide-adenine-dinucleotide: G23 (= G19), G26 (= G22), F27 (= F23), I28 (= I24), D47 (= D43), N48 (= N44), S50 (= S46), T51 (= T47), G52 (= G48), D78 (= D68), I79 (= I69), Q98 (= Q88), A99 (= A89), A100 (= A90), T117 (≠ V107), A140 (= A130), A141 (= A131), S142 (= S132), Y166 (= Y156), K170 (= K160), Y193 (= Y183), V196 (= V186)
- binding [[(2R,3S,4R,5R)-5-[2,4-bis(oxidanylidene)pyrimidin-1-yl]-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl][(2R,3R,4R,5R,6R)-6-(hydroxymethyl)-4,5-bis(oxidanyl)-3-(2-oxidanylidenepropyl)oxan-2-yl] hydrogen phosphate: G102 (= G92), S103 (= S93), S142 (= S132), S143 (= S133), S144 (= S134), Y166 (= Y156), Y193 (= Y183), N195 (= N185), A209 (= A199), V210 (= V200), K213 (= K203), W214 (≠ F204), Y225 (≠ R215), I226 (= I216), N227 (= N217), R234 (= R224), L271 (= L282), R294 (= R311), D297 (= D314), V298 (= V315), S301 (= S318)
3rufA Alternative analogs as viable substrates of udp-hexose 4-epimerases
52% identity, 92% coverage: 16:348/362 of query aligns to 20:331/336 of 3rufA
- active site: S142 (= S132), S143 (= S133), S144 (= S134), Y166 (= Y156), K170 (= K160), N204 (≠ D194)
- binding nicotinamide-adenine-dinucleotide: G23 (= G19), G26 (= G22), F27 (= F23), I28 (= I24), D47 (= D43), N48 (= N44), S50 (= S46), T51 (= T47), G52 (= G48), D78 (= D68), I79 (= I69), Q98 (= Q88), A99 (= A89), A100 (= A90), T117 (≠ V107), A140 (= A130), Y166 (= Y156), K170 (= K160), Y193 (= Y183), V196 (= V186)
- binding uridine-5'-diphosphate: N195 (= N185), A209 (= A199), V210 (= V200), K213 (= K203), W214 (≠ F204), Y225 (≠ R215), I226 (= I216), N227 (= N217), R234 (= R224), L271 (= L282), R294 (= R311), D297 (= D314)
3lu1A Crystal structure analysis of wbgu: a udp-galnac 4-epimerase (see paper)
52% identity, 92% coverage: 16:348/362 of query aligns to 20:331/336 of 3lu1A
- active site: S142 (= S132), S143 (= S133), S144 (= S134), Y166 (= Y156), K170 (= K160), N204 (≠ D194)
- binding glycine: Q135 (= Q125), K187 (≠ E177)
- binding nicotinamide-adenine-dinucleotide: G23 (= G19), G26 (= G22), F27 (= F23), I28 (= I24), D47 (= D43), N48 (= N44), S50 (= S46), T51 (= T47), G52 (= G48), D78 (= D68), I79 (= I69), Q98 (= Q88), A99 (= A89), A100 (= A90), A140 (= A130), A141 (= A131), S142 (= S132), Y166 (= Y156), K170 (= K160), Y193 (= Y183), N195 (= N185)
- binding uridine-diphosphate-n-acetylgalactosamine: S103 (= S93), S142 (= S132), S143 (= S133), S144 (= S134), Y166 (= Y156), N195 (= N185), V210 (= V200), W214 (≠ F204), Y225 (≠ R215), I226 (= I216), N227 (= N217), R234 (= R224), L271 (= L282), R294 (= R311), D297 (= D314)
1sb8A Crystal structure of pseudomonas aeruginosa udp-n-acetylglucosamine 4- epimerase complexed with udp-n-acetylgalactosamine (see paper)
52% identity, 92% coverage: 16:348/362 of query aligns to 20:336/341 of 1sb8A
- active site: S142 (= S132), S143 (= S133), S144 (= S134), Y166 (= Y156), K170 (= K160), N204 (≠ D194)
- binding nicotinamide-adenine-dinucleotide: G23 (= G19), G26 (= G22), F27 (= F23), I28 (= I24), D47 (= D43), N48 (= N44), F49 (= F45), T51 (= T47), G52 (= G48), D78 (= D68), I79 (= I69), Q98 (= Q88), A100 (= A90), T117 (≠ V107), A140 (= A130), A141 (= A131), Y166 (= Y156), K170 (= K160), Y193 (= Y183), N195 (= N185), V196 (= V186)
- binding uridine-diphosphate-n-acetylgalactosamine: S103 (= S93), S142 (= S132), S143 (= S133), S144 (= S134), Y166 (= Y156), N195 (= N185), A209 (= A199), V210 (= V200), W214 (≠ F204), Y225 (≠ R215), I226 (= I216), N227 (= N217), R234 (= R224), L271 (= L282), R299 (= R311), D302 (= D314), S306 (= S318)
1sb9A Crystal structure of pseudomonas aeruginosa udp-n-acetylglucosamine 4- epimerase complexed with udp-glucose (see paper)
52% identity, 92% coverage: 16:348/362 of query aligns to 19:335/340 of 1sb9A
- active site: S141 (= S132), S142 (= S133), S143 (= S134), Y165 (= Y156), K169 (= K160), N203 (≠ D194)
- binding nicotinamide-adenine-dinucleotide: G22 (= G19), G25 (= G22), F26 (= F23), I27 (= I24), D46 (= D43), N47 (= N44), F48 (= F45), T50 (= T47), G51 (= G48), D77 (= D68), I78 (= I69), Q97 (= Q88), A99 (= A90), T116 (≠ V107), A139 (= A130), A140 (= A131), Y165 (= Y156), K169 (= K160), Y192 (= Y183), N194 (= N185), V195 (= V186)
- binding uridine-5'-diphosphate-glucose: S141 (= S132), Y165 (= Y156), N194 (= N185), A208 (= A199), V209 (= V200), W213 (≠ F204), Y224 (≠ R215), I225 (= I216), N226 (= N217), L270 (= L282), R298 (= R311), D301 (= D314)
6dntA Udp-n-acetylglucosamine 4-epimerase from methanobrevibacter ruminantium m1 in complex with udp-n-acetylmuramic acid (see paper)
35% identity, 94% coverage: 10:348/362 of query aligns to 1:306/310 of 6dntA
- active site: S120 (= S132), S121 (= S133), A122 (≠ S134), Y144 (= Y156), K148 (= K160), A187 (= A199)
- binding (2R)-2-{[(2R,3R,4R,5S,6R)-3-(acetylamino)-2-{[(S)-{[(R)-{[(2R,3S,4R,5R)-5-(2,4-dioxo-3,4-dihydropyrimidin-1(2H)-yl)-3,4-dihydroxytetrahydrofuran-2-yl]methoxy}(hydroxy)phosphoryl]oxy}(hydroxy)phosphoryl]oxy}-5-hydroxy-6-(hydroxymethyl)tetrahydro-2H-pyran-4-yl]oxy}propanoic acid: A80 (≠ G92), S120 (= S132), S121 (= S133), Y144 (= Y156), F172 (= F184), N173 (= N185), A187 (= A199), V188 (= V200), K191 (= K203), V203 (≠ R215), I204 (= I216), Y205 (≠ N217), Q210 (≠ F222), R212 (= R224), I246 (≠ L282), R269 (= R311), D272 (= D314)
- binding nicotinamide-adenine-dinucleotide: G10 (= G19), G13 (= G22), F14 (= F23), I15 (= I24), D33 (= D43), N34 (= N44), L35 (≠ F45), S36 (= S46), S37 (≠ T47), G38 (= G48), D57 (= D68), L58 (≠ I69), L76 (≠ Q88), A77 (= A89), A78 (= A90), A80 (≠ G92), S118 (≠ A130), S119 (≠ A131), Y144 (= Y156), K148 (= K160), Y171 (= Y183), V174 (= V186)
- binding zinc ion: E209 (≠ S221), H275 (= H317)
4zrnA Crystal structure of udp-glucose 4-epimerase (tm0509) with udp-glucose from hyperthermophilic eubacterium thermotoga maritima (see paper)
34% identity, 94% coverage: 15:353/362 of query aligns to 3:309/309 of 4zrnA
- active site: T117 (≠ S132), G119 (vs. gap), A120 (≠ S134), Y143 (= Y156), K147 (= K160), Y181 (≠ D194), G185 (≠ A199)
- binding nicotinamide-adenine-dinucleotide: G7 (= G19), G10 (= G22), F11 (= F23), I12 (= I24), D31 (= D43), N32 (= N44), S34 (= S46), S35 (≠ T47), G36 (= G48), S51 (= S63), I52 (≠ L64), L73 (≠ Q88), A74 (= A89), A75 (= A90), T92 (≠ V107), S115 (≠ A130), S116 (≠ A131), Y143 (= Y156), K147 (= K160), Y170 (= Y183), V173 (= V186)
- binding uridine-5'-diphosphate-glucose: T117 (≠ S132), G119 (vs. gap), A120 (≠ S134), Y143 (= Y156), N172 (= N185), G185 (≠ A199), V186 (= V200), H201 (≠ R215), F203 (≠ N217), Y208 (≠ F222), R210 (= R224), V244 (≠ L282), R267 (= R311), D270 (= D314)
6wjaA Udp-glcnac c4-epimerase mutant s121a/y146f from pseudomonas protegens in complex with udp-galnac (see paper)
33% identity, 91% coverage: 14:341/362 of query aligns to 2:300/307 of 6wjaA
- active site: A118 (≠ S132), A119 (≠ S133), A120 (≠ S134), F143 (≠ Y156), K147 (= K160)
- binding nicotinamide-adenine-dinucleotide: G7 (= G19), G10 (= G22), F11 (= F23), I12 (= I24), D31 (= D43), D32 (≠ N44), S34 (= S46), T35 (= T47), G36 (= G48), A55 (≠ I69), L74 (≠ Q88), A75 (= A89), A76 (= A90), S93 (≠ V107), F143 (≠ Y156), K147 (= K160), F170 (≠ Y183), F171 (= F184), I173 (≠ V186)
- binding uridine-diphosphate-n-acetylgalactosamine: V80 (= V94), A120 (≠ S134), N172 (= N185), G186 (≠ A199), V187 (= V200), F191 (= F204), T202 (≠ R215), F204 (≠ N217), R211 (= R224), L247 (= L282), R270 (= R311), D273 (= D314)
6wj9B Udp-glcnac c4-epimerase mutant s121a/y146f from pseudomonas protegens in complex with udp-glcnac (see paper)
33% identity, 91% coverage: 14:341/362 of query aligns to 3:301/308 of 6wj9B
- active site: A119 (≠ S132), A120 (≠ S133), A121 (≠ S134), F144 (≠ Y156), K148 (= K160)
- binding nicotinamide-adenine-dinucleotide: G8 (= G19), G11 (= G22), F12 (= F23), I13 (= I24), D32 (= D43), D33 (≠ N44), S35 (= S46), T36 (= T47), G37 (= G48), D55 (= D68), A56 (≠ I69), L75 (≠ Q88), A76 (= A89), A77 (= A90), S94 (≠ V107), A117 (= A130), A119 (≠ S132), F144 (≠ Y156), K148 (= K160), F171 (≠ Y183), F172 (= F184), I174 (≠ V186)
- binding uridine-diphosphate-n-acetylglucosamine: V81 (= V94), N173 (= N185), G187 (≠ A199), V188 (= V200), F192 (= F204), T203 (≠ R215), L204 (≠ I216), F205 (≠ N217), R212 (= R224), L248 (= L282), R271 (= R311), D274 (= D314)
6pnlA Structure of epimerase mth375 from the thermophilic pseudomurein- containing methanogen methanothermobacter thermautotrophicus
31% identity, 96% coverage: 12:358/362 of query aligns to 15:336/336 of 6pnlA
- active site: S133 (= S132), C135 (≠ S133), G136 (≠ S134), Y159 (= Y156), K163 (= K160)
- binding nicotinamide-adenine-dinucleotide: G22 (= G19), G25 (= G22), C26 (≠ F23), D46 (= D43), N47 (= N44), L48 (≠ F45), S49 (= S46), S50 (≠ T47), S51 (≠ G48), D68 (= D68), I69 (= I69), L89 (≠ Q88), A91 (= A90), F93 (≠ G92), V108 (= V107), S131 (≠ A130), S133 (= S132), Y159 (= Y156), K163 (= K160), F186 (≠ Y183), N188 (= N185), V189 (= V186), R200 (≠ A198)
- binding uridine-5'-diphosphate: N188 (= N185), N201 (≠ A199), V202 (= V200), F206 (= F204), P217 (≠ R215), I218 (= I216), T219 (≠ N217), R226 (= R224), V262 (≠ K290), R285 (= R311)
6pmhA Structure of epimerase mth375 from the thermophilic pseudomurein- containing methanogen methanothermobacter thermautotrophicus
31% identity, 96% coverage: 12:358/362 of query aligns to 9:330/330 of 6pmhA
- active site: S127 (= S132), C129 (≠ S133), G130 (≠ S134), Y153 (= Y156), K157 (= K160)
- binding adenosine monophosphate: G16 (= G19), G19 (= G22), D40 (= D43), N41 (= N44), S43 (= S46), S44 (≠ T47), S45 (≠ G48), D62 (= D68), I63 (= I69), A84 (= A89), F87 (≠ G92), R194 (≠ A198)
- binding uridine-5'-diphosphate: C129 (≠ S133), N182 (= N185), N195 (≠ A199), V196 (= V200), F200 (= F204), P211 (≠ R215), I212 (= I216), T213 (≠ N217), R220 (= R224), V256 (≠ K290), R279 (= R311)
7ystA Crystal structure of udp-glucose 4-epimerase (rv3634c) in complex with both udp-glucose and udp-galactose in chain b from mycobacterium tuberculosis
33% identity, 93% coverage: 14:350/362 of query aligns to 2:310/312 of 7ystA
- binding nicotinamide-adenine-dinucleotide: G7 (= G19), G10 (= G22), F11 (= F23), I12 (= I24), D31 (= D43), N32 (= N44), T35 (= T47), G36 (= G48), D56 (= D68), I57 (= I69), L77 (≠ Q88), A78 (= A89), A79 (= A90), I81 (≠ G92), V96 (= V107), T119 (≠ A130), Y146 (= Y156), K150 (= K160), P173 (≠ Y183), A174 (≠ F184), N175 (= N185), V176 (= V186)
- binding uridine-5'-diphosphate-glucose: I81 (≠ G92), R84 (≠ P95), S121 (= S132), G123 (≠ S133), Y146 (= Y156), A174 (≠ F184), N175 (= N185), A187 (= A198), G188 (≠ A199), V189 (= V200), F193 (= F204), R204 (= R215), V205 (≠ I216), F206 (≠ N217), R213 (≠ Y228), D248 (≠ L282), R271 (= R311)
7ysmA Crystal structure of udp-glucose 4-epimerase (rv3634c) co-crystallized with udp-n-acetylglucosamine from mycobacterium tuberculosis
33% identity, 93% coverage: 14:350/362 of query aligns to 2:310/311 of 7ysmA
- binding nicotinamide-adenine-dinucleotide: G7 (= G19), G10 (= G22), F11 (= F23), I12 (= I24), D31 (= D43), N32 (= N44), T35 (= T47), G36 (= G48), D56 (= D68), I57 (= I69), L77 (≠ Q88), A78 (= A89), A79 (= A90), I81 (≠ G92), T119 (≠ A130), Y146 (= Y156), K150 (= K160), P173 (≠ Y183), N175 (= N185), V176 (= V186)
- binding uridine-diphosphate-n-acetylgalactosamine: I81 (≠ G92), R84 (≠ P95), S121 (= S132), G123 (≠ S133), S124 (= S134), Y146 (= Y156), A174 (≠ F184), N175 (= N185), G188 (≠ A199), V189 (= V200), F193 (= F204), R204 (= R215), V205 (≠ I216), F206 (≠ N217), N211 (≠ F226), R213 (≠ Y228), D248 (≠ L282), R271 (= R311)
7ys9A Crystal structure of udp-glucose 4-epimerase (rv3634c) in complex with both udp-glucose and udp-galactose in chaina from mycobacterium tuberculosis
33% identity, 93% coverage: 14:348/362 of query aligns to 2:308/310 of 7ys9A
- binding galactose-uridine-5'-diphosphate: I81 (≠ G92), R84 (≠ P95), S121 (= S132), G123 (≠ S133), Y146 (= Y156), A174 (≠ F184), N175 (= N185), A187 (= A198), G188 (≠ A199), V189 (= V200), F193 (= F204), R204 (= R215), F206 (≠ N217), N211 (≠ F226), R213 (≠ Y228), D248 (≠ L282), R271 (= R311)
- binding nicotinamide-adenine-dinucleotide: G7 (= G19), G10 (= G22), F11 (= F23), I12 (= I24), D31 (= D43), N32 (= N44), A34 (≠ S46), T35 (= T47), G36 (= G48), D56 (= D68), I57 (= I69), L77 (≠ Q88), A78 (= A89), A79 (= A90), I81 (≠ G92), T119 (≠ A130), Y146 (= Y156), K150 (= K160), P173 (≠ Y183), A174 (≠ F184), V176 (= V186)
- binding uridine-5'-diphosphate-glucose: I81 (≠ G92), R84 (≠ P95), S121 (= S132), G123 (≠ S133), Y146 (= Y156), A174 (≠ F184), N175 (= N185), A187 (= A198), G188 (≠ A199), V189 (= V200), F193 (= F204), R204 (= R215), F206 (≠ N217), N211 (≠ F226), R213 (≠ Y228), D248 (≠ L282), R271 (= R311)
5u4qA 1.5 angstrom resolution crystal structure of NAD-dependent epimerase from klebsiella pneumoniae in complex with NAD.
31% identity, 94% coverage: 14:353/362 of query aligns to 3:320/321 of 5u4qA
- binding nicotinamide-adenine-dinucleotide: G8 (= G19), G11 (= G22), F12 (= F23), I13 (= I24), D32 (= D43), N33 (= N44), N35 (≠ S46), Y38 (≠ K49), K43 (≠ E54), D61 (= D68), L62 (≠ I69), L83 (≠ Q88), A84 (= A89), A85 (= A90), A118 (= A130), Y145 (= Y156), K149 (= K160), F172 (≠ Y183), F173 (= F184), T174 (≠ N185), V175 (= V186), R181 (≠ D192)
5u4qB 1.5 angstrom resolution crystal structure of NAD-dependent epimerase from klebsiella pneumoniae in complex with NAD.
29% identity, 94% coverage: 14:353/362 of query aligns to 3:304/304 of 5u4qB
- binding nicotinamide-adenine-dinucleotide: G8 (= G19), G11 (= G22), F12 (= F23), I13 (= I24), D32 (= D43), N33 (= N44), N35 (≠ S46), Y38 (≠ K49), K43 (≠ E54), D61 (= D68), L62 (≠ I69), L83 (≠ Q88), A84 (= A89), A85 (= A90), A123 (= A130), Y150 (= Y156), K154 (= K160), F177 (≠ Y183), V180 (= V186), R186 (≠ D192), M189 (≠ G195)
6zllA Crystal structure of udp-glucuronic acid 4-epimerase from bacillus cereus in complex with udp-galacturonic acid and NAD (see paper)
30% identity, 91% coverage: 14:341/362 of query aligns to 2:303/321 of 6zllA
- active site: T126 (≠ S132), S127 (= S133), S128 (= S134), Y149 (= Y156), K153 (= K160)
- binding nicotinamide-adenine-dinucleotide: G7 (= G19), G10 (= G22), F11 (= F23), I12 (= I24), D32 (= D43), H33 (≠ N44), F34 (= F45), I35 (vs. gap), K43 (= K49), D62 (= D68), I63 (= I69), L81 (≠ Q88), A82 (= A89), A83 (= A90), I124 (≠ A130), T126 (≠ S132), Y149 (= Y156), K153 (= K160), Y176 (= Y183), V179 (= V186), R185 (≠ D192), M188 (≠ G195)
- binding (2S,3R,4S,5R,6R)-6-[[[(2R,3S,4R,5R)-5-(2,4-dioxopyrimidin-1-yl)-3,4-dihydroxy-oxolan-2-yl]methoxy-hydroxy-phosphoryl]oxy-hydroxy-phosphoryl]oxy-3,4,5-trihydroxy-oxane-2-carboxylic acid: P85 (≠ G92), V87 (= V94), R88 (≠ P95), T126 (≠ S132), S127 (= S133), Y149 (= Y156), T178 (≠ N185), R185 (≠ D192), A189 (= A196), R192 (≠ K203), T204 (≠ R215), F206 (≠ N217), Q211 (≠ F222), R213 (= R224), I250 (≠ L282), E276 (≠ I303)
6zldA Crystal structure of udp-glucuronic acid 4-epimerase from bacillus cereus in complex with udp-glucuronic acid and NAD (see paper)
30% identity, 91% coverage: 14:341/362 of query aligns to 2:303/314 of 6zldA
- active site: T126 (≠ S132), S127 (= S133), S128 (= S134), Y149 (= Y156), K153 (= K160)
- binding nicotinamide-adenine-dinucleotide: G7 (= G19), G10 (= G22), F11 (= F23), I12 (= I24), D32 (= D43), H33 (≠ N44), F34 (= F45), I35 (vs. gap), K43 (= K49), D62 (= D68), I63 (= I69), L81 (≠ Q88), A82 (= A89), A83 (= A90), I124 (≠ A130), T126 (≠ S132), K153 (= K160), Y176 (= Y183), T178 (≠ N185), R185 (≠ D192), M188 (≠ G195)
- binding uridine-5'-diphosphate-glucuronic acid: P85 (≠ G92), R88 (≠ P95), T126 (≠ S132), S127 (= S133), S128 (= S134), Y149 (= Y156), F177 (= F184), T178 (≠ N185), R185 (≠ D192), M188 (≠ G195), A189 (= A196), R192 (≠ K203), T204 (≠ R215), F206 (≠ N217), Q211 (≠ F222), R213 (= R224), I250 (≠ L282), E276 (≠ I303)
6zl6A Crystal structure of udp-glucuronic acid 4-epimerase from bacillus cereus in complex with udp and NAD (see paper)
30% identity, 91% coverage: 14:341/362 of query aligns to 2:303/314 of 6zl6A
- active site: T126 (≠ S132), S127 (= S133), S128 (= S134), Y149 (= Y156), K153 (= K160)
- binding nicotinamide-adenine-dinucleotide: G7 (= G19), G10 (= G22), F11 (= F23), I12 (= I24), D32 (= D43), H33 (≠ N44), F34 (= F45), I35 (vs. gap), K43 (= K49), D62 (= D68), I63 (= I69), L81 (≠ Q88), A82 (= A89), A83 (= A90), I124 (≠ A130), T126 (≠ S132), K153 (= K160), Y176 (= Y183), T178 (≠ N185), V179 (= V186), R185 (≠ D192), M188 (≠ G195)
- binding uridine-5'-diphosphate: T178 (≠ N185), A189 (= A196), R192 (≠ K203), T204 (≠ R215), F206 (≠ N217), Q211 (≠ F222), R213 (= R224), I250 (≠ L282), E276 (≠ I303)
Query Sequence
>Echvi_4409 FitnessBrowser__Cola:Echvi_4409
MIGTTEGHQLSGAKVLVTGGAGFIGSNLIDALLEAGSRVVCLDNFSTGKRTNLEKALTSS
RFSLIEGDIRDYTTCAEAVEGCKWVFHQAALGSVPRSIADPMTSTDVNIGGFVKVLFAAK
EAGVQRVVYAASSSTYGDHPDLPKVEHVIGNALSPYAITKYVDELFAKNFADTYGLETIG
LRYFNVFGRRQDPDGAYAAVIPKFVRCLVEGESPRINGDGSFSRDFTYIDNVIQANVKAA
VTGTALMKANLAEYHAHIGRPFNTDAVISEVFNVAFGERVNLNELGSYLKEELSKFDKEI
SGIPMEYGPQRAGDVPHSLASIEKGRKVIGYEPEYSVRQGLGLACEWYWNSFKKERNFEA
DF
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory