Comparing Echvi_4514 FitnessBrowser__Cola:Echvi_4514 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3qdkA Structural insight on mechanism and diverse substrate selection strategy of ribulokinase (see paper)
36% identity, 97% coverage: 5:542/557 of query aligns to 2:524/546 of 3qdkA
3l0qA The crystal structure of xlylulose kinase from yersinia pseudotuberculosis
26% identity, 97% coverage: 4:544/557 of query aligns to 2:528/541 of 3l0qA
5ya2A Crystal structure of lsrk-hpr complex with adp (see paper)
21% identity, 96% coverage: 2:535/557 of query aligns to 1:472/478 of 5ya2A
5ya1A Crystal structure of lsrk-hpr complex with atp (see paper)
21% identity, 96% coverage: 2:535/557 of query aligns to 1:472/478 of 5ya1A
Q5HGD2 Glycerol kinase; ATP:glycerol 3-phosphotransferase; Glycerokinase; GK; EC 2.7.1.30 from Staphylococcus aureus (strain COL)
31% identity, 20% coverage: 403:511/557 of query aligns to 349:457/498 of Q5HGD2
Sites not aligning to the query:
3ge1A 2.7 angstrom crystal structure of glycerol kinase (glpk) from staphylococcus aureus in complex with adp and glycerol
31% identity, 20% coverage: 403:511/557 of query aligns to 350:458/499 of 3ge1A
Sites not aligning to the query:
2w41B Crystal structure of plasmodium falciparum glycerol kinase with adp (see paper)
26% identity, 25% coverage: 373:511/557 of query aligns to 326:467/507 of 2w41B
Sites not aligning to the query:
2w40A Crystal structure of plasmodium falciparum glycerol kinase with bound glycerol (see paper)
26% identity, 25% coverage: 373:511/557 of query aligns to 320:461/501 of 2w40A
Sites not aligning to the query:
P18157 Glycerol kinase; ATP:glycerol 3-phosphotransferase; Glycerokinase; GK; EC 2.7.1.30 from Bacillus subtilis (strain 168) (see paper)
24% identity, 29% coverage: 381:544/557 of query aligns to 327:487/496 of P18157
Sites not aligning to the query:
3h3nX Glycerol kinase h232r with glycerol (see paper)
27% identity, 26% coverage: 401:543/557 of query aligns to 348:484/501 of 3h3nX
Sites not aligning to the query:
6k76A Glycerol kinase form thermococcus kodakarensis, complex structure with substrate.
22% identity, 95% coverage: 6:532/557 of query aligns to 1:461/485 of 6k76A
O34153 Glycerol kinase; ATP:glycerol 3-phosphotransferase; Glycerokinase; GK; EC 2.7.1.30 from Enterococcus casseliflavus (Enterococcus flavescens) (see 3 papers)
27% identity, 26% coverage: 401:543/557 of query aligns to 349:485/506 of O34153
Sites not aligning to the query:
1bu6Y Crystal structures of escherichia coli glycerol kinase and the mutant a65t in an inactive tetramer: conformational changes and implications for allosteric regulation (see paper)
23% identity, 25% coverage: 393:530/557 of query aligns to 339:474/499 of 1bu6Y
Sites not aligning to the query:
1gllO Escherichia coli glycerol kinase mutant with bound atp analog showing substantial domain motion (see paper)
23% identity, 25% coverage: 393:530/557 of query aligns to 335:470/494 of 1gllO
Sites not aligning to the query:
1gljO Escherichia coli glycerol kinase mutant with bound atp analog showing substantial domain motion (see paper)
23% identity, 25% coverage: 393:530/557 of query aligns to 335:470/494 of 1gljO
Sites not aligning to the query:
1glfO Crystal structures of escherichia coli glycerol kinase and the mutant a65t in an inactive tetramer: conformational changes and implications for allosteric regulation (see paper)
23% identity, 25% coverage: 393:530/557 of query aligns to 339:474/498 of 1glfO
Sites not aligning to the query:
1bwfO Escherichia coli glycerol kinase mutant with bound atp analog showing substantial domain motion (see paper)
23% identity, 25% coverage: 393:530/557 of query aligns to 335:470/494 of 1bwfO
Sites not aligning to the query:
1bo5O Crystal structure of the complex between escherichia coli glycerol kinase and the allosteric regulator fructose 1,6-bisphosphate. (see paper)
23% identity, 25% coverage: 393:530/557 of query aligns to 339:474/498 of 1bo5O
Sites not aligning to the query:
P0A6F3 Glycerol kinase; ATP:glycerol 3-phosphotransferase; Glycerokinase; GK; EC 2.7.1.30 from Escherichia coli (strain K12) (see 10 papers)
23% identity, 25% coverage: 393:530/557 of query aligns to 341:476/502 of P0A6F3
Sites not aligning to the query:
1gldG Cation promoted association (cpa) of a regulatory and target protein is controlled by phosphorylation (see paper)
23% identity, 25% coverage: 393:530/557 of query aligns to 330:465/489 of 1gldG
Sites not aligning to the query:
>Echvi_4514 FitnessBrowser__Cola:Echvi_4514
MSKNFVIGVDFGTDSVRSILVDTLDGKIVKSAVYRYPRWSKKLYCDAGSHQFRQHPLDHL
EGLEHTVSAIIRDSGIDPDSVKGIGVATTGSSPIPVDENGDALSMSSRFSNNPNAMVVLW
KDHTAVAEAEEITKAAKNGEVDYTAFSGGSYSSEWFWAKILSVYKKDPGVARNTCTWMEH
CDFIVGQLTGERPLNLKRSRTAAGHKAMWNKKWSGLPPASFWGGISPELGSLRETLYEQT
FHGSEKAGHLCSKWAEKLGLSADTAVAVGTLDAHAGAVGAGISPNTLVKVVGTSTCDILV
GSPTDPELDPIEGICGQVEDAVLPGTIGLEAGQAGFGDVLAWFAEVVLGPSRQIIHRSTQ
LDAVIKETIIEELEHSILDELSREALELAPCLNGASALDWINGRRSPFAKETLKGAFLNL
HMGTQASHMFRAMVEALCFGSKKIIDHLEGKGLTVEEIIAIGGVANKSPLVMQTMADIIG
KPIKIAASKEAPALGAAIHAAVASKVYPSMDQAVAKMVPAFKKVYSPDLQHQQVYVEKYK
MYEREGEVVENLKLTTQ
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory