SitesBLAST
Comparing Echvi_4660 FitnessBrowser__Cola:Echvi_4660 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P9WP51 Probable cystathionine beta-synthase Rv1077; Beta-thionase; Serine sulfhydrase; EC 4.2.1.22 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
44% identity, 100% coverage: 2:456/456 of query aligns to 3:460/464 of P9WP51
- K428 (≠ S424) modified: Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-Cter in protein Pup)
7xoyA Cystathionine beta-synthase of mycobacterium tuberculosis in the presence of s-adenosylmethionine and serine. (see paper)
44% identity, 100% coverage: 2:456/456 of query aligns to 1:458/458 of 7xoyA
7xnzB Native cystathionine beta-synthase of mycobacterium tuberculosis. (see paper)
44% identity, 100% coverage: 2:456/456 of query aligns to 1:458/458 of 7xnzB
7qgtB Crystal structure of human cystathionine beta-synthase (delta516-525) in complex with aoaa. (see paper)
38% identity, 99% coverage: 2:454/456 of query aligns to 36:485/500 of 7qgtB
- binding protoporphyrin ix containing fe: A186 (≠ L150), P189 (≠ W153), L190 (≠ K154), Y193 (= Y157), R226 (≠ K190)
- binding 4'-deoxy-4'-acetylyamino-pyridoxal-5'-phosphate: K79 (= K43), T106 (= T70), S107 (= S71), N109 (= N73), T110 (= T74), Q182 (= Q146), G216 (= G180), T217 (= T181), G218 (= G182), T220 (= T184), G265 (= G232), S309 (= S276), P335 (= P303), D336 (= D304)
Sites not aligning to the query:
7qgtA Crystal structure of human cystathionine beta-synthase (delta516-525) in complex with aoaa. (see paper)
38% identity, 99% coverage: 2:454/456 of query aligns to 36:485/500 of 7qgtA
- binding protoporphyrin ix containing fe: A186 (≠ L150), P189 (≠ W153), L190 (≠ K154), Y193 (= Y157), R226 (≠ K190)
- binding pyridoxal-5'-phosphate: K79 (= K43), N109 (= N73), G216 (= G180), T217 (= T181), G218 (= G182), T220 (= T184), G265 (= G232), S309 (= S276), P335 (= P303), D336 (= D304)
Sites not aligning to the query:
P35520 Cystathionine beta-synthase; Beta-thionase; Serine sulfhydrase; EC 4.2.1.22 from Homo sapiens (Human) (see 40 papers)
39% identity, 97% coverage: 2:442/456 of query aligns to 76:519/551 of P35520
- P78 (≠ N4) to R: in CBSD; severe form; associated in cis with N-102; decreased cystathionine beta-synthase activity; decreased homotetramer formation; dbSNP:rs786204608
- G85 (= G11) to R: in CBSD; loss of cystathionine beta-synthase activity; dbSNP:rs863223435
- T87 (= T13) to N: in CBSD; decreased cystathionine beta-synthase activity; increased aggregation
- L101 (≠ I25) to P: in CBSD; common mutation in Irish population; loss of activity; dbSNP:rs786204757
- K102 (= K26) to N: in CBSD; associated in cis with R-78; decreased cystathionine beta-synthase activity; decreased homotetramer formation; dbSNP:rs786204609; to Q: in dbSNP:rs34040148
- C109 (≠ V33) to R: in CBSD; loss of activity; dbSNP:rs778220779
- A114 (≠ P38) to V: in CBSD; mild form; when linked with W-58 severe form; decreased cystathionine beta-synthase activity; decreases homotetramer formation by promoting formation of larger aggregates; dbSNP:rs121964964
- K119 (= K43) modified: N6-(pyridoxal phosphate)lysine
- R125 (≠ K49) to Q: in CBSD; severe form; when linked with D-131 moderate form; loss of cystathionine beta-synthase activity; decreased homotetramer formation; dbSNP:rs781444670; to W: in CBSD; exhibits an activity lower than 4% of the wild-type enzyme; absent capacity to form multimeric quaternary structure; dbSNP:rs886057100
- M126 (= M50) to V: in CBSD; loss of activity
- E131 (= E55) to D: in CBSD; linked with Q-125; loss of activity; dbSNP:rs1555875351
- G139 (= G63) to R: in CBSD; mild form; dbSNP:rs121964965
- I143 (= I67) to M: in CBSD; 4% of activity; stable; dbSNP:rs370167302
- E144 (= E68) to K: in CBSD; loss of cystathionine beta-synthase activity; impaired stimulation by AdoMet and AdoHcy; decreased homotetramer formation; dbSNP:rs121964966
- G148 (= G72) to R: in CBSD; loss of cystathionine beta-synthase activity; impaired stimulation by AdoMet and AdoHcy; loss of homotetramer formation; dbSNP:rs755952006
- N149 (= N73) binding
- L154 (= L78) to Q: in CBSD; protein expression is comparable to wild-type; significant decrease of enzyme activity
- A155 (= A79) to T: in CBSD; complete loss of activity; severely affects homotetramer formation by promoting formation of larger aggregates; dbSNP:rs1429138569; to V: in CBSD; protein expression is comparable to wild-type; significant decrease of enzyme activity
- C165 (= C89) to Y: in CBSD; severe form; protein expression is comparable to wild-type; loss of cystathionine beta-synthase activity; no effect on homotetramer formation; dbSNP:rs1347651454
- M173 (≠ Q97) to V: in CBSD; presents 40% of the wild-type activity; highly reduced capacity to form multimeric quaternary structure; natural variant: Missing (in CBSD; loss of activity)
- E176 (= E100) to K: in CBSD; severe form; loss of cystathionine beta-synthase activity; inhibited by AdoMet; severely decreases homotetramer formation by promoting formation of larger aggregates; dbSNP:rs762065361
- V180 (= V104) to A: in CBSD; decreased cystathionine beta-synthase activity; decreases homotetramer formation; dbSNP:rs1555875010
- T191 (≠ C115) to M: in CBSD; moderate and severe forms; loss of cystathionine beta-synthase activity; absent capacity to form multimeric quaternary structure; dbSNP:rs121964973
- K211 (≠ N135) modified: Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO)
- A226 (≠ L150) to T: in CBSD; presents 20% of the wild-type activity; dramatically reduced capacity to form multimeric quaternary structure; dbSNP:rs763835246
- N228 (= N152) to K: in CBSD; loss of cystathionine beta-synthase activity; decreased homotetramer formation; dbSNP:rs1464223176; to S: in CBSD; has significantly decreased levels of enzyme activity; dbSNP:rs1555874803
- A231 (= A155) to P: in CBSD; has significantly decreased levels of enzyme activity
- D234 (≠ E158) to N: in CBSD; decreased cystathionine beta-synthase activity; changed localization; decreased interaction with pyridoxal 5'-phosphate; no effect on homotetramer formation; dbSNP:rs773734233; natural variant: Missing (in CBSD; protein expression is comparable to wild-type; significant decrease of enzyme activity)
- GTGGT 256:260 (= GTGGT 180:184) binding
- T257 (= T181) to M: in CBSD; moderate to severe form; protein expression is comparable to wild-type; significant decrease of enzyme activity; dbSNP:rs758236584
- T262 (≠ S186) to M: in CBSD; moderate form; dbSNP:rs149119723; to R: in CBSD; severe form; loss of cystathionine beta-synthase activity; loss of homotetramer formation
- R266 (≠ K190) to K: in CBSD; mild form; decreased cystathionine beta-synthase activity; decreased homotetramer formation; no effect on heme-binding; decreased stability; dbSNP:rs121964969
- K269 (= K193) natural variant: Missing (in CBSD; loss of expression)
- C272 (≠ N196) mutation to A: Reduced heme content and cystathionine beta-synthase activity.
- C275 (≠ I199) to Y: in CBSD; severe form; exhibits an activity lower than 4% of the wild-type enzyme; absent capacity to form multimeric quaternary structure; mutation to S: Reduced heme content and cystathionine beta-synthase activity.
- I278 (≠ V202) to S: in CBSD; loss of activity; to T: in CBSD; mild to severe form; common mutation; decreased expression; loss of cystathionine beta-synthase activity; impaired stimulation by AdoMet and AdoHcy; severely affects homotetramer formation by promoting formation of larger aggregates; dbSNP:rs5742905
- D281 (= D205) to N: in CBSD; loss of activity
- A288 (≠ K215) to T: in CBSD; protein expression is comparable to wild-type; significant decrease of enzyme activity; dbSNP:rs141502207
- E302 (≠ L229) to K: in CBSD; no effect on cystathionine beta-synthase activity; inhibited by AdoHcy and impaired activation by AdoMet; no effect on homotetramer formation; dbSNP:rs779270933
- G305 (= G232) to R: in CBSD; loss of cystathionine beta-synthase activity; no effect on homotetramer formation
- G307 (= G234) to S: in CBSD; moderate to severe form; linked with D-534; common mutation; loss of cystathionine beta-synthase activity; impaired stimulation by AdoMet and AdoHcy; no effect on homotetramer formation; dbSNP:rs121964962
- V320 (≠ I247) to A: in CBSD; has 36% of wild-type enzyme activity; dbSNP:rs781567152
- D321 (= D248) to V: in CBSD; loss of activity
- R336 (= R263) to C: in CBSD; protein expression is comparable to wild-type; loss of activity; absent capacity to form multimeric quaternary structure; dbSNP:rs398123151; to H: in CBSD; mild form; no effect on expression; exhibits an activity lower than 4% of the wild-type enzyme; altered stimulation by AdoMet; absent capacity to form multimeric quaternary structure; dbSNP:rs760417941
- L338 (= L265) to P: in CBSD; severe form; exhibits an activity lower than 4% of the wild-type enzyme; absent capacity to form multimeric quaternary structure
- G347 (= G274) to S: in CBSD; protein expression is comparable to wild-type; loss of activity; dbSNP:rs771298943
- S349 (= S276) binding ; to N: in CBSD; severe form; exhibits an activity lower than 4% of the wild-type enzyme; absent capacity to form multimeric quaternary structure
- T353 (≠ A280) to M: in CBSD; protein expression is comparable to wild-type; significant decrease of enzyme activity; dbSNP:rs121964972
- R369 (≠ T297) to C: in CBSD; when linked with C-491 severe form; decreased cystathionine beta-synthase activity; decreased homotetramer formation; dbSNP:rs117687681
- D376 (= D304) to N: in CBSD; has significantly decreased levels of enzyme activity; dbSNP:rs1170128038
- R379 (≠ T307) to Q: in CBSD; exhibits an activity lower than 4% of the wild-type enzyme; absent capacity to form multimeric quaternary structure; dbSNP:rs763036586
- K384 (= K312) to E: in CBSD; severe form; dbSNP:rs121964967
- P422 (≠ K356) to L: in CBSD; changed cystathionine beta-synthase activity; impaired stimulation by AdoMet; does not affect homotetramer formation; dbSNP:rs28934892
- P427 (vs. gap) to L: in CBSD; no effect on cystathionine beta-synthase activity; altered stimulation by AdoMet; dbSNP:rs863223434
- I435 (= I359) to T: in CBSD; no effect on cystathionine beta-synthase activity; impaired stimulation by AdoMet and AdoHcy; does not affect homotetramer formation
- R439 (≠ N363) to Q: in CBSD; no effect on cystathionine beta-synthase activity; increased homotetramer formation; dbSNP:rs756467921
- D444 (≠ S368) to N: in CBSD; decreased expression; no effect on cystathionine beta-synthase activity; altered stimulation by AdoMet; increased homotetramer formation; dbSNP:rs28934891
- V449 (= V373) to G: in CBSD; no effect on cystathionine beta-synthase activity; altered stimulation by AdoMet
- L456 (≠ I379) to P: in CBSD; severe; exhibits an activity lower than 4% of the wild-type enzyme; absent capacity to form multimeric quaternary structure
- S466 (≠ T389) to L: in CBSD; increased cystathionine beta-synthase activity; impaired stimulation by AdoMet and AdoHcy; decreased homotetramer formation; dbSNP:rs121964971
- S500 (= S423) to L: in CBSD; no effect on cystathionine beta-synthase activity; altered stimulation by AdoMet; dbSNP:rs755106884
Sites not aligning to the query:
- 18 R → C: results in 1/3 to 2/3 the enzyme activity of the wild-type; dbSNP:rs201827340
- 49 P → L: in CBSD; decreased expression; no effect on cystathionine beta-synthase activity; increased homotetramer formation; dbSNP:rs148865119
- 52 binding axial binding residue
- 58 R → W: in CBSD; linked with V-114; 18% of activity; dbSNP:rs555959266
- 65 binding axial binding residue; H → R: in CBSD; decreased cystathionine beta-synthase activity; inhibited by AdoMet and AdoHcy; decreased homotetramer formation; dbSNP:rs1191141364
- 69 A → P: in dbSNP:rs17849313
- 526 Q → K: in CBSD; has significantly decreased levels of enzyme activity
- 539 L → S: in CBSD; loss of cystathionine beta-synthase activity; impaired stimulation by AdoMet and AdoHcy; loss of homotetramer formation; dbSNP:rs121964968
- 540 L → Q: in CBSD; no effect on cystathionine beta-synthase activity; altered stimulation by AdoMet
- 548 R → Q: presents 60% of the wild-type activity; highly reduced capacity to form multimeric quaternary structure; dbSNP:rs150828989
4pcuA Crystal structure of delta516-525 e201s human cystathionine beta- synthase with adomet (see paper)
38% identity, 98% coverage: 2:450/456 of query aligns to 34:481/486 of 4pcuA
- active site: K77 (= K43), S105 (= S71), D237 (= D205), S305 (= S276)
- binding protoporphyrin ix containing fe: A182 (≠ L150), P185 (≠ W153), L186 (≠ K154), Y189 (= Y157), R222 (≠ K190), T269 (≠ A240)
- binding pyridoxal-5'-phosphate: K77 (= K43), N107 (= N73), G212 (= G180), T213 (= T181), G214 (= G182), T216 (= T184), G261 (= G232), S305 (= S276), P331 (= P303), D332 (= D304)
- binding s-adenosylmethionine: P376 (≠ K356), G396 (≠ S366), F397 (≠ V367), D398 (≠ S368), Q399 (= Q369), T476 (= T445), I478 (≠ H447), D479 (= D448)
Sites not aligning to the query:
Q2V0C9 Cystathionine beta-synthase; EC 4.2.1.22 from Apis mellifera (Honeybee) (see paper)
40% identity, 100% coverage: 2:455/456 of query aligns to 35:494/504 of Q2V0C9
- K78 (= K43) modified: N6-(pyridoxal phosphate)lysine
- N108 (= N73) binding
- GTGGT 215:219 (= GTGGT 180:184) binding
- S307 (= S276) binding
Sites not aligning to the query:
- 12 binding axial binding residue
- 23 binding axial binding residue
3pc4A Full length structure of cystathionine beta-synthase from drosophila in complex with serine (see paper)
38% identity, 95% coverage: 2:434/456 of query aligns to 39:474/504 of 3pc4A
- active site: K82 (= K43), S312 (= S276)
- binding protoporphyrin ix containing fe: A189 (≠ L150), P192 (≠ W153), L193 (≠ K154), Y196 (= Y157), R229 (≠ K190), T276 (≠ A240)
- binding (E)-N-({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methylidene)-L-serine: K82 (= K43), T109 (= T70), S110 (= S71), N112 (= N73), T113 (= T74), Q185 (= Q146), A218 (≠ V179), G219 (= G180), T220 (= T181), A221 (≠ G182), T223 (= T184), G268 (= G232), I269 (= I233), Y271 (≠ E235), S312 (= S276), P338 (= P303), D339 (= D304)
Sites not aligning to the query:
3pc3A Full length structure of cystathionine beta-synthase from drosophila in complex with aminoacrylate (see paper)
38% identity, 95% coverage: 2:434/456 of query aligns to 39:474/504 of 3pc3A
- active site: K82 (= K43), S312 (= S276)
- binding protoporphyrin ix containing fe: A189 (≠ L150), P192 (≠ W153), L193 (≠ K154), Y196 (= Y157), R229 (≠ K190)
- binding 2-[({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)amino]acrylic acid: K82 (= K43), T109 (= T70), S110 (= S71), N112 (= N73), T113 (= T74), Q185 (= Q146), A218 (≠ V179), G219 (= G180), T220 (= T181), A221 (≠ G182), T223 (= T184), G268 (= G232), I269 (= I233), S312 (= S276), P338 (= P303), D339 (= D304)
Sites not aligning to the query:
3pc2A Full length structure of cystathionine beta-synthase from drosophila (see paper)
38% identity, 95% coverage: 2:434/456 of query aligns to 37:472/500 of 3pc2A
- active site: K80 (= K43), S310 (= S276)
- binding protoporphyrin ix containing fe: A187 (≠ L150), P190 (≠ W153), L191 (≠ K154), Y194 (= Y157), R227 (≠ K190)
- binding pyridoxal-5'-phosphate: K80 (= K43), N110 (= N73), A216 (≠ V179), G217 (= G180), T218 (= T181), A219 (≠ G182), T221 (= T184), G266 (= G232), S310 (= S276), P336 (= P303), D337 (= D304)
Sites not aligning to the query:
5ohxA Structure of active cystathionine b-synthase from apis mellifera (see paper)
40% identity, 100% coverage: 2:455/456 of query aligns to 31:487/488 of 5ohxA
- binding protoporphyrin ix containing fe: P181 (≠ L150), P184 (≠ W153), Y188 (= Y157), R221 (≠ K190)
- binding pyridoxal-5'-phosphate: K74 (= K43), N104 (= N73), G209 (= G178), G211 (= G180), T212 (= T181), G213 (= G182), G214 (= G183), T215 (= T184), G256 (= G232), S300 (= S276), P326 (= P303), D327 (= D304)
Sites not aligning to the query:
6c4pA Crystal structures of cystathionine beta-synthase from saccharomyces cerevisiae: the structure of the pmp complex (see paper)
44% identity, 71% coverage: 4:327/456 of query aligns to 8:338/344 of 6c4pA
- binding calcium ion: N179 (vs. gap), D182 (≠ G170), N183 (≠ K171)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: K49 (= K43), N80 (= N73), A191 (≠ V179), G192 (= G180), T193 (= T181), G194 (= G182), T196 (= T184), G241 (= G232), S285 (= S276), P314 (= P303), D315 (= D304)
6c2zA Crystal structures of cystathionine beta-synthase from saccharomyces cerevisiae: the structure of the plp-aminoacrylate intermediate (see paper)
44% identity, 71% coverage: 4:327/456 of query aligns to 9:339/345 of 6c2zA
- binding calcium ion: N180 (vs. gap), D183 (≠ G170), N184 (≠ K171)
- binding 2-[({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)amino]acrylic acid: K50 (= K43), T78 (= T70), S79 (= S71), N81 (= N73), T82 (= T74), Q154 (= Q146), A192 (≠ V179), G193 (= G180), T194 (= T181), G195 (= G182), T197 (= T184), G242 (= G232), S286 (= S276), P315 (= P303), D316 (= D304)
6c2qA Crystal structures of cystathionine beta-synthase from saccharomyces cerevisiae: the structure of the plp-l-serine intermediate (see paper)
44% identity, 71% coverage: 4:327/456 of query aligns to 9:339/345 of 6c2qA
- binding calcium ion: N180 (vs. gap), D183 (≠ G170), N184 (≠ K171)
- binding L-Serine, N-[[3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]-4-pyridinyl]methylene]: K50 (= K43), T78 (= T70), S79 (= S71), N81 (= N73), T82 (= T74), Q154 (= Q146), A192 (≠ V179), G193 (= G180), T194 (= T181), G195 (= G182), T197 (= T184), G242 (= G232), Y245 (≠ E235), S286 (= S276), P315 (= P303), D316 (= D304)
6c2hA Crystal structures of cystathionine beta-synthase from saccharomyces cerevisiae: the structure of the catalytic core (see paper)
44% identity, 71% coverage: 4:327/456 of query aligns to 9:339/345 of 6c2hA
- binding calcium ion: N180 (vs. gap), D183 (≠ G170), N184 (≠ K171)
- binding pyridoxal-5'-phosphate: K50 (= K43), N81 (= N73), A192 (≠ V179), G193 (= G180), T194 (= T181), G195 (= G182), T197 (= T184), G242 (= G232), S286 (= S276), P315 (= P303), D316 (= D304)
6xwlC Cystathionine beta-synthase from toxoplasma gondii (see paper)
35% identity, 98% coverage: 2:450/456 of query aligns to 8:470/477 of 6xwlC
6xylA Crystal structure of delta466-491 cystathionine beta-synthase from toxoplasma gondii with l-serine (see paper)
36% identity, 98% coverage: 2:450/456 of query aligns to 8:461/468 of 6xylA
- binding 2-[({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)amino]acrylic acid: K51 (= K43), T82 (= T74), Q154 (= Q146), G188 (= G180), T189 (= T181), G190 (= G182), T192 (= T184), G238 (= G232), I239 (= I233), Y241 (≠ E235), S282 (= S276), P308 (= P303), D309 (= D304)
6vjuB Crystal structure of cystathionine beta synthase from legionella pneumophila with llp, plp, and homocysteine
47% identity, 71% coverage: 1:325/456 of query aligns to 2:317/317 of 6vjuB
G5EFH8 Cystathionine beta-synthase cbs-1; Beta-thionase; Serine sulfhydrase; EC 4.2.1.22 from Caenorhabditis elegans (see paper)
42% identity, 71% coverage: 1:326/456 of query aligns to 377:703/704 of G5EFH8
- K421 (= K43) mutation to A: Binds significantly less of the PLP cofactor. Altered fluorescence-based tryptophan spectra.
Query Sequence
>Echvi_4660 FitnessBrowser__Cola:Echvi_4660
MIYNSIIDTIGDTPLVKLNRLNKGIKGTIYVKVEYFNPGNSVKDRMAIKMIDDAEKAGIL
KPGGTIIEGTSGNTGMGLALVGIARGYKCIFTMADKQSKEKIDVLKAMGAEVVVCPTNVS
PDDPRSYYSVAKKLNKDIPNSFYPNQYDNLSNWKAHYETTGPEIWKDTEGKITHFAAGVG
TGGTMSGTAKYLKEQNPSIVSVGIDTYGSVFKKYKETGEFDENEIYPYLTEGIGEDILPA
NVDFSMIDHFVKVTDKDSAVMTRRLSREEGLFVGWSCGSAVHGALEYARQHLTEQDTMVI
ILPDHGTRYLGKVYNDDWMKNHGFLEDTTFGTARDIISSRNGSYELVVAKKGEKVKAAIH
LMNERSVSQIPVVEDGNVIGSLTDTKLLTKIIQKPELKDAPVEEVMEDSMKFVALDSTLD
VLSSMVDKDKAVLVRDDLHQIHIITKHDILGAITKG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory