Comparing Echvi_4679 FitnessBrowser__Cola:Echvi_4679 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P07821 Iron(3+)-hydroxamate import ATP-binding protein FhuC; Ferric hydroxamate uptake protein C; Ferrichrome transport ATP-binding protein FhuC; Iron(III)-hydroxamate import ATP-binding protein FhuC; EC 7.2.2.16 from Escherichia coli (strain K12) (see 2 papers)
32% identity, 64% coverage: 30:244/337 of query aligns to 30:244/265 of P07821
P12866 Alpha-factor-transporting ATPase; Mating factor A secretion protein STE6; Multiple drug resistance protein homolog; P-glycoprotein; EC 7.4.2.7 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see 2 papers)
30% identity, 70% coverage: 1:236/337 of query aligns to 350:591/1290 of P12866
Sites not aligning to the query:
5xu1B Structure of a non-canonical abc transporter from streptococcus pneumoniae r6 (see paper)
33% identity, 62% coverage: 11:220/337 of query aligns to 7:215/226 of 5xu1B
1oxvD Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
30% identity, 67% coverage: 11:235/337 of query aligns to 7:228/353 of 1oxvD
1oxvA Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
30% identity, 67% coverage: 11:235/337 of query aligns to 7:228/353 of 1oxvA
1oxuA Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
30% identity, 67% coverage: 11:235/337 of query aligns to 7:228/353 of 1oxuA
Q97UY8 Glucose import ATP-binding protein GlcV; EC 7.5.2.- from Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) (Sulfolobus solfataricus) (see paper)
30% identity, 67% coverage: 11:235/337 of query aligns to 7:228/353 of Q97UY8
7arlD Lolcde in complex with lipoprotein and adp (see paper)
31% identity, 64% coverage: 7:220/337 of query aligns to 2:215/222 of 7arlD
7mdyC Lolcde nucleotide-bound
31% identity, 64% coverage: 7:220/337 of query aligns to 2:215/226 of 7mdyC
P75957 Lipoprotein-releasing system ATP-binding protein LolD; EC 7.6.2.- from Escherichia coli (strain K12) (see paper)
31% identity, 64% coverage: 7:220/337 of query aligns to 5:218/233 of P75957
7v8iD Lolcd(e171q)e with bound amppnp in nanodiscs (see paper)
31% identity, 64% coverage: 7:220/337 of query aligns to 4:217/229 of 7v8iD
5x40A Structure of a cbio dimer bound with amppcp (see paper)
32% identity, 65% coverage: 24:243/337 of query aligns to 18:234/280 of 5x40A
Sites not aligning to the query:
P9WQK5 Uncharacterized ABC transporter ATP-binding protein Rv0073 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
32% identity, 58% coverage: 11:207/337 of query aligns to 7:202/330 of P9WQK5
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
28% identity, 65% coverage: 23:240/337 of query aligns to 14:228/241 of 4u00A
Sites not aligning to the query:
1f3oA Crystal structure of mj0796 atp-binding cassette (see paper)
30% identity, 60% coverage: 11:211/337 of query aligns to 5:209/232 of 1f3oA
7m33C The structure of bacillus subtilis bmrcd in the inward-facing conformation bound to hoechst-33342 and atp (see paper)
31% identity, 65% coverage: 22:239/337 of query aligns to 345:562/573 of 7m33C
Sites not aligning to the query:
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
27% identity, 64% coverage: 24:240/337 of query aligns to 14:228/240 of 4ymuJ
Sites not aligning to the query:
8fhkC Heterodimeric abc transporter bmrcd in the occluded conformation bound to atp: bmrcd_oc-atp (see paper)
31% identity, 65% coverage: 22:239/337 of query aligns to 344:561/574 of 8fhkC
8t1pC Heterodimeric abc transporter bmrcd in the occluded conformation bound to adpvi: bmrcd_oc-adpvi (see paper)
31% identity, 65% coverage: 22:239/337 of query aligns to 344:561/574 of 8t1pC
1jj7A Crystal structure of thE C-terminal atpase domain of human tap1 (see paper)
32% identity, 63% coverage: 26:236/337 of query aligns to 29:239/251 of 1jj7A
Sites not aligning to the query:
>Echvi_4679 FitnessBrowser__Cola:Echvi_4679
MDKANYILEGKNVAIGYRKGKYPLKVSEHLDFQLSAGKLTCLLGPNGVGKSTLIKTLMGQ
LPPLAGDITFAGIPLHQQHPRQLAQKISVVLTDRITAGNLTVQQLVALGRTPFTNWLGKL
SSEDQHIIKEALQATKTLYLKDQLISEISDGQLQKVMIARALAQDGQLIILDEPTAHLDL
INRYETMHLLREITKRQGKSILVVTHDLEIAVETADHLWIMQCGEPLTTGTPEDLIISDK
INLLTTGSGLAFDKNTGKIRLTSPRDLINIQGPPHLVQWLKLALLKNGITLPQRIVINVT
DAPPTFGITGDGYTETVHDIQSVISRLHERLDSDSHS
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory