Comparing GFF1013 FitnessBrowser__Marino:GFF1013 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 15 hits to proteins with known functional sites (download)
6v1rA Crystal structure of iachsnfr fluorescent acetylcholine sensor precursor binding protein
34% identity, 90% coverage: 24:299/305 of query aligns to 1:269/278 of 6v1rA
7s7xA Crystal structure of icytsnfr cytisine sensor precursor binding protein with varenicline bound
34% identity, 90% coverage: 24:299/305 of query aligns to 1:269/278 of 7s7xA
B5Z7I3 Ergothioneine transport permease/ergothioneine binding protein EgtU from Helicobacter pylori (strain G27) (see paper)
28% identity, 90% coverage: 27:302/305 of query aligns to 289:551/553 of B5Z7I3
8dp7A Structure of helicobacter pylori egtu bound to egt (see paper)
28% identity, 90% coverage: 27:302/305 of query aligns to 1:263/265 of 8dp7A
7s7tA Inicsnfr3a nicotine sensor comprising periplasmic binding sequence plus fluorescent sequence with varenicline bound (see paper)
32% identity, 65% coverage: 101:299/305 of query aligns to 314:502/509 of 7s7tA
Sites not aligning to the query:
7txlA Crystal structure of egtu solute binding domain from streptococcus pneumoniae d39 in complex with l-ergothioneine (see paper)
28% identity, 91% coverage: 23:299/305 of query aligns to 1:267/275 of 7txlA
A0A0H2ZQB9 Ergothioneine transporter EgtUBC from Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) (see paper)
28% identity, 90% coverage: 28:300/305 of query aligns to 237:499/506 of A0A0H2ZQB9
1sw1A Crystal structure of prox from archeoglobus fulgidus in complex with proline betaine (see paper)
29% identity, 89% coverage: 28:299/305 of query aligns to 3:263/270 of 1sw1A
3r6uA Crystal structure of choline binding protein opubc from bacillus subtilis (see paper)
25% identity, 86% coverage: 39:301/305 of query aligns to 18:267/272 of 3r6uA
6eylA Crystal structure of opubc in complex with carnitine
25% identity, 86% coverage: 39:301/305 of query aligns to 25:274/280 of 6eylA
Sites not aligning to the query:
6eyhA Structure of a opubc mutant with bound glycine betaine
25% identity, 86% coverage: 39:301/305 of query aligns to 25:274/280 of 6eyhA
5nxyA Crystal structure of opuac from b. Subtilis in complex with arsenobetaine (see paper)
25% identity, 86% coverage: 39:301/305 of query aligns to 18:267/272 of 5nxyA
3ppoA Structures of the substrate-binding protein provide insights into the multiple compatible solutes binding specificities of bacillus subtilis abc transporter opuc (see paper)
23% identity, 90% coverage: 26:301/305 of query aligns to 1:267/272 of 3ppoA
3pprA Structures of the substrate-binding protein provide insights into the multiple compatible solutes binding specificities of bacillus subtilis abc transporter opuc (see paper)
23% identity, 87% coverage: 36:301/305 of query aligns to 10:266/271 of 3pprA
3ppqA Structures of the substrate-binding protein provide insights into the multiple compatible solutes binding specificities of bacillus subtilis abc transporter opuc (see paper)
23% identity, 87% coverage: 36:301/305 of query aligns to 10:266/271 of 3ppqA
>GFF1013 FitnessBrowser__Marino:GFF1013
MTPKSLLRRTAALIAFVMSGSVMAADPVVVSSKIDTEGSVLGQMVLQSLEGAGIPVENRL
QLGGTSIVRNAIKAGEIDIYPEYTGNAAFFHDQADLDIWKDADKAYQEAARLDKEAHNIV
WLEPAEANNTWAMSVRGDLARENNLATLEDLADYINEGGAFKFAASAEFVESASALPAFQ
EAYGFKLESDQLLILSGGNTAATLRAAALNNNDVNGAMTYGTDGGLDALDLKVMEDTAGV
QPVYQPAPIVRGEVLEAYPQIREVLTPIFESLDLETLQRLNGQVAVNGVPADTVARDYLD
SLAQD
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory