Comparing GFF1251 FitnessBrowser__Phaeo:GFF1251 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 13 hits to proteins with known functional sites (download)
3i09A Crystal structure of a periplasmic binding protein (bma2936) from burkholderia mallei at 1.80 a resolution
25% identity, 85% coverage: 44:426/448 of query aligns to 4:361/375 of 3i09A
8hicA Crystal structure of urta from prochlorococcus marinus str. Mit 9313 in complex with urea and calcium
22% identity, 83% coverage: 44:417/448 of query aligns to 4:359/395 of 8hicA
Sites not aligning to the query:
3td9A Crystal structure of a leucine binding protein livk (tm1135) from thermotoga maritima msb8 at 1.90 a resolution
24% identity, 62% coverage: 97:374/448 of query aligns to 35:304/350 of 3td9A
Sites not aligning to the query:
4gnrA 1.0 angstrom resolution crystal structure of the branched-chain amino acid transporter substrate binding protein livj from streptococcus pneumoniae str. Canada mdr_19a in complex with isoleucine
24% identity, 79% coverage: 44:398/448 of query aligns to 2:328/348 of 4gnrA
4n0qB Crystal structure of an abc transporter, substrate-binding protein from brucella melitensis 16m in complex with l-leucine using a crystal grown in a crystal former (microlytic)
24% identity, 73% coverage: 45:371/448 of query aligns to 3:302/345 of 4n0qB
7s6eB Crystal structure of urta from synechococcus cc9311 in complex with urea and calcium
20% identity, 75% coverage: 44:380/448 of query aligns to 9:331/400 of 7s6eB
Sites not aligning to the query:
4zpjA Abc transporter substrate-binding protein from sphaerobacter thermophilus
22% identity, 63% coverage: 99:381/448 of query aligns to 39:324/371 of 4zpjA
4q6wA Crystal structure of periplasmic binding protein type 1 from bordetella pertussis tohama i complexed with 3-hydroxy benzoic acid
25% identity, 33% coverage: 43:192/448 of query aligns to 2:142/376 of 4q6wA
Sites not aligning to the query:
3ipcA Structure of atu2422-gaba f77a mutant receptor in complex with leucine (see paper)
24% identity, 75% coverage: 45:379/448 of query aligns to 3:310/348 of 3ipcA
3ip9A Structure of atu2422-gaba receptor in complex with gaba (see paper)
24% identity, 75% coverage: 45:379/448 of query aligns to 3:310/348 of 3ip9A
3ip7A Structure of atu2422-gaba receptor in complex with valine (see paper)
24% identity, 75% coverage: 45:379/448 of query aligns to 3:310/348 of 3ip7A
Sites not aligning to the query:
3ip6A Structure of atu2422-gaba receptor in complex with proline (see paper)
24% identity, 75% coverage: 45:379/448 of query aligns to 3:310/348 of 3ip6A
3ip5A Structure of atu2422-gaba receptor in complex with alanine (see paper)
24% identity, 75% coverage: 45:379/448 of query aligns to 3:310/348 of 3ip5A
>GFF1251 FitnessBrowser__Phaeo:GFF1251
MSKTDVSRRGVLKTGAIAGAGVALPTIFTASSAAAFTNEPTGSTVTLGFNVPQTGPYADE
GADELRAYQLAVEHLNGGGDGGMMNTFSSKALQGNGIMGKEVKFVTGDTQTKSDAARASA
KSMIEKDGAVMITGGSSSGVAIAVQGLCQEAGVIFMAGLTHSNDTTGKDKKANGFRHFFN
GYMSGAALAPVLKNLYGTDRNAYHLTADYTWGWTQEESIAAATEALGWNTVNKVRTPLAA
TDFSSYIAPVLNSGADVLVLNHYGGNMVNSLTNAVQFGLREKVVNGKNFEIVVPLYSRLM
AKGAGANVKGIHGSTNWHWSLQDEGSQAFVRSFGSKYGFPPSQAAHTVYCQTLLYADAVE
RAGSFNPCAVVEALEGFEFDGLGNGKTLYRAEDHQCFKDVLVVRGKENPTSEFDLLEVVE
VTPAEQVTYAPDHPMFAGGALGTCNSGA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory