SitesBLAST
Comparing GFF1270 FitnessBrowser__Phaeo:GFF1270 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7ahhC Opua inhibited inward-facing, sbd docked (see paper)
37% identity, 81% coverage: 40:264/279 of query aligns to 37:272/382 of 7ahhC
Sites not aligning to the query:
- binding (2R,3R,3aS,5R,7aR,9R,10R,10aS,12R,14aR)-2,9-bis(6-amino-9H-purin-9-yl)octahydro-2H,7H-difuro[3,2-d:3',2'-j][1,3,7,9,2,8]tetraoxadiphosphacyclododecine-3,5,10,12-tetrol 5,12-dioxide: 275, 297, 298
- binding phosphoaminophosphonic acid-adenylate ester: 12
7aheC Opua inhibited inward facing (see paper)
37% identity, 81% coverage: 40:264/279 of query aligns to 37:272/382 of 7aheC
Sites not aligning to the query:
- binding (2R,3R,3aS,5R,7aR,9R,10R,10aS,12R,14aR)-2,9-bis(6-amino-9H-purin-9-yl)octahydro-2H,7H-difuro[3,2-d:3',2'-j][1,3,7,9,2,8]tetraoxadiphosphacyclododecine-3,5,10,12-tetrol 5,12-dioxide: 275, 297, 298
7ahdC Opua (e190q) occluded (see paper)
38% identity, 73% coverage: 40:242/279 of query aligns to 37:244/260 of 7ahdC
- binding adenosine-5'-triphosphate: T39 (≠ V42), S61 (= S64), G62 (= G65), G64 (= G67), K65 (= K68), S66 (≠ T69), T67 (= T70), Q111 (= Q107), K161 (≠ W157), Q162 (= Q158), S164 (= S160), G166 (= G162), M167 (= M163), Q188 (≠ E184), H221 (= H217)
Sites not aligning to the query:
2awnB Crystal structure of the adp-mg-bound e. Coli malk (crystallized with atp-mg) (see paper)
40% identity, 73% coverage: 40:242/279 of query aligns to 13:214/374 of 2awnB
Sites not aligning to the query:
3puyA Crystal structure of an outward-facing mbp-maltose transporter complex bound to amp-pnp after crystal soaking of the pretranslocation state (see paper)
40% identity, 73% coverage: 40:242/279 of query aligns to 13:214/371 of 3puyA
- binding phosphoaminophosphonic acid-adenylate ester: S37 (= S64), G38 (= G65), C39 (= C66), G40 (= G67), K41 (= K68), S42 (≠ T69), T43 (= T70), Q81 (= Q107), R128 (≠ K154), A132 (≠ Q158), S134 (= S160), G136 (= G162), Q137 (≠ M163), E158 (= E184), H191 (= H217)
- binding magnesium ion: S42 (≠ T69), Q81 (= Q107)
Sites not aligning to the query:
3puxA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-bef3 (see paper)
40% identity, 73% coverage: 40:242/279 of query aligns to 13:214/371 of 3puxA
- binding adenosine-5'-diphosphate: G38 (= G65), C39 (= C66), G40 (= G67), K41 (= K68), S42 (≠ T69), T43 (= T70), R128 (≠ K154), S134 (= S160), Q137 (≠ M163)
- binding beryllium trifluoride ion: S37 (= S64), G38 (= G65), K41 (= K68), Q81 (= Q107), S134 (= S160), G136 (= G162), H191 (= H217)
- binding magnesium ion: S42 (≠ T69), Q81 (= Q107)
Sites not aligning to the query:
3puwA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-alf4 (see paper)
40% identity, 73% coverage: 40:242/279 of query aligns to 13:214/371 of 3puwA
- binding adenosine-5'-diphosphate: V17 (≠ A44), G38 (= G65), C39 (= C66), G40 (= G67), K41 (= K68), S42 (≠ T69), T43 (= T70), R128 (≠ K154), A132 (≠ Q158), S134 (= S160), Q137 (≠ M163)
- binding tetrafluoroaluminate ion: S37 (= S64), G38 (= G65), K41 (= K68), Q81 (= Q107), S134 (= S160), G135 (= G161), G136 (= G162), E158 (= E184), H191 (= H217)
- binding magnesium ion: S42 (≠ T69), Q81 (= Q107)
Sites not aligning to the query:
3puvA Crystal structure of an outward-facing mbp-maltose transporter complex bound to adp-vo4 (see paper)
40% identity, 73% coverage: 40:242/279 of query aligns to 13:214/371 of 3puvA
- binding adenosine-5'-diphosphate: V17 (≠ A44), G38 (= G65), C39 (= C66), G40 (= G67), K41 (= K68), S42 (≠ T69), T43 (= T70), R128 (≠ K154), A132 (≠ Q158), S134 (= S160), Q137 (≠ M163)
- binding magnesium ion: S42 (≠ T69), Q81 (= Q107)
Sites not aligning to the query:
P68187 Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 from Escherichia coli (strain K12) (see 5 papers)
40% identity, 73% coverage: 40:242/279 of query aligns to 14:215/371 of P68187
- A85 (≠ G110) mutation to M: Suppressor of EAA loop mutations in MalFG.
- K106 (≠ S131) mutation to C: Suppressor of EAA loop mutations in MalFG.
- V114 (= V139) mutation to C: Suppressor of EAA loop mutations in MalFG.
- V117 (= V142) mutation to M: Suppressor of EAA loop mutations in MalFG.
- E119 (= E144) mutation to K: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- A124 (= A149) mutation to T: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- G137 (= G162) mutation to A: Loss of maltose transport. Has greater ability to decrease mal gene expression than wild-type MalK.
- D158 (= D183) mutation to N: Loss of maltose transport but retains ability to repress mal genes.
Sites not aligning to the query:
- 228 R→C: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 241 F→I: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 267 W→G: Normal maltose transport but constitutive mal gene expression.
- 278 G→P: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 282 S→L: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 284 G→S: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 302 G→D: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 308 E→Q: Maltose transport is affected but retains ability to interact with MalT.
- 322 S→F: Resistant to inhibitory effects of alpha-methylglucoside but retains transport capacity.
- 340 G→A: Maltose transport is affected but retains ability to interact with MalT.
- 346 G→S: Normal maltose transport but constitutive mal gene expression.
- 355 F→Y: Maltose transport is affected but retains ability to interact with MalT.
1q12A Crystal structure of the atp-bound e. Coli malk (see paper)
40% identity, 73% coverage: 40:242/279 of query aligns to 11:212/367 of 1q12A
- binding adenosine-5'-triphosphate: S35 (= S64), G36 (= G65), C37 (= C66), G38 (= G67), K39 (= K68), S40 (≠ T69), T41 (= T70), R126 (≠ K154), A130 (≠ Q158), S132 (= S160), G134 (= G162), Q135 (≠ M163)
Sites not aligning to the query:
P19566 Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
40% identity, 73% coverage: 40:242/279 of query aligns to 14:215/369 of P19566
- L86 (= L111) mutation to F: Loss of transport. No effect on ATP-binding activity but decrease in ATP hydrolysis. Retains repressor activity.
- P160 (= P185) mutation to L: Loss of transport. No effect on ATP-binding activity but decrease in ATP hydrolysis. Retains repressor activity.
- D165 (= D190) mutation to N: Loss of transport. No effect on ATP-binding activity but decrease in ATP hydrolysis. Retains repressor activity.
Sites not aligning to the query:
- 306 E→K: Loss of transport. No effect on ATP-binding and ATP hydrolysis. Retains repressor activity.
8hplC Lpqy-sugabc in state 1 (see paper)
38% identity, 70% coverage: 37:232/279 of query aligns to 9:205/384 of 8hplC
2d62A Crystal structure of multiple sugar binding transport atp- binding protein
38% identity, 70% coverage: 40:233/279 of query aligns to 17:217/375 of 2d62A
8hprD Lpqy-sugabc in state 4 (see paper)
38% identity, 68% coverage: 44:232/279 of query aligns to 18:207/362 of 8hprD
- binding adenosine-5'-triphosphate: S38 (= S64), C40 (= C66), G41 (= G67), K42 (= K68), S43 (≠ T69), T44 (= T70), Q82 (= Q107), R129 (≠ K154), Q133 (= Q158), S135 (= S160), G136 (= G161), G137 (= G162), Q159 (≠ E184), H192 (= H217)
- binding magnesium ion: S43 (≠ T69), Q82 (= Q107)
Sites not aligning to the query:
8hprC Lpqy-sugabc in state 4 (see paper)
38% identity, 68% coverage: 44:232/279 of query aligns to 18:207/363 of 8hprC
- binding adenosine-5'-triphosphate: S38 (= S64), G39 (= G65), G41 (= G67), K42 (= K68), S43 (≠ T69), Q82 (= Q107), Q133 (= Q158), G136 (= G161), G137 (= G162), Q138 (≠ M163), H192 (= H217)
- binding magnesium ion: S43 (≠ T69), Q82 (= Q107)
Sites not aligning to the query:
P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
40% identity, 69% coverage: 48:239/279 of query aligns to 36:226/378 of P69874
- F45 (= F57) mutation to L: Lower ATPase activity and transport efficiency.
- C54 (= C66) mutation to T: Loss of ATPase activity and transport.
- L60 (= L72) mutation to F: Lower ATPase activity and transport efficiency.
- L76 (≠ V88) mutation to P: Lower ATPase activity and transport efficiency.
- V135 (= V146) mutation to M: Loss of ATPase activity and transport.
- D172 (= D183) mutation to N: Loss of ATPase activity and transport.
Sites not aligning to the query:
- 26 C→A: Lower ATPase activity and transport efficiency.
- 27 F→L: Lower ATPase activity and transport efficiency.
- 276 C→A: Lower ATPase activity and transport efficiency.
- 297 mutation E->K,D: Lower ATPase activity and transport efficiency.; E→Q: Loss of ATPase activity and transport.
1f3oA Crystal structure of mj0796 atp-binding cassette (see paper)
39% identity, 72% coverage: 25:224/279 of query aligns to 1:211/232 of 1f3oA
P9WQI3 Trehalose import ATP-binding protein SugC; MtbSugC; Nucleotide-binding domain of SugABC transporter; NBD of SugABC transporter; SugABC transporter ATPase SugC; EC 7.5.2.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
36% identity, 76% coverage: 44:255/279 of query aligns to 19:229/393 of P9WQI3
- H193 (= H217) mutation to A: Decreased hydrolysis of ATP. No change in KM, but 2-fold reduction in Vmax compared to wild-type.
1l2tA Dimeric structure of mj0796, a bacterial abc transporter cassette (see paper)
39% identity, 72% coverage: 25:224/279 of query aligns to 1:211/230 of 1l2tA
- binding adenosine-5'-triphosphate: Y11 (≠ F35), S40 (= S64), G41 (= G65), S42 (≠ C66), G43 (= G67), K44 (= K68), S45 (≠ T69), T46 (= T70), F138 (= F151), Q145 (= Q158), S147 (= S160), G149 (= G162), Q150 (≠ M163), H204 (= H217)
1g291 Malk (see paper)
36% identity, 70% coverage: 40:233/279 of query aligns to 14:214/372 of 1g291
- binding magnesium ion: D69 (= D94), E71 (≠ A96), K72 (≠ R97), K79 (≠ R98), D80 (≠ Q99)
- binding pyrophosphate 2-: S38 (= S64), G39 (= G65), C40 (= C66), G41 (= G67), K42 (= K68), T43 (= T69), T44 (= T70)
Sites not aligning to the query:
Query Sequence
>GFF1270 FitnessBrowser__Phaeo:GFF1270
MNMETTTQALNSQAAASDITPQVPVIEARNLDLTFQTNDGPVHALKDVSLEINKGDFVSF
IGPSGCGKTTFLRCIAALEQPTGGALMVNGMTPDEARRQRAYGYVFQAAGLYPWRSIAKN
IKLPLEIMGYSKAEQAARVEQVLELVELAGFGGKYPWQLSGGMQQRASIARALAFDADIL
LMDEPFGALDEIVRDHLNEQLLKLWARTDKTIGFVTHSIPEAVYLSTKIVVMSPRPGRIH
DVIDSPLPKERPLDIRDSAEFIEIAHRVRDGLRAGHADD
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory