Comparing GFF1392 FitnessBrowser__WCS417:GFF1392 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 4 hits to proteins with known functional sites (download)
8hkbA Tpa bound-form of periplasmic terephthalate binding protein (tbp) from ideonella sakaiensis mutant k184d (see paper)
28% identity, 68% coverage: 27:248/327 of query aligns to 2:215/302 of 8hkbA
Sites not aligning to the query:
2dvzA Structure of a periplasmic transporter (see paper)
27% identity, 86% coverage: 31:312/327 of query aligns to 8:284/300 of 2dvzA
7ndsA Crystal structure of tphc in a closed conformation (see paper)
22% identity, 89% coverage: 31:321/327 of query aligns to 6:289/294 of 7ndsA
7ndrD Crystal structure of tphc in an open conformation (see paper)
22% identity, 89% coverage: 31:321/327 of query aligns to 6:289/293 of 7ndrD
>GFF1392 FitnessBrowser__WCS417:GFF1392
MTPSLRKLALAAGCMLFAGQLLAADEPKRPECIAPASPGGGFDLTCKLAQSALVNEKLLS
KPMRVTYMPGGVGAVAYNAVVAQRPADAGTLVAWSSGSLLNLAQGKFGRFDESAVRWLAA
VGTSYGAIAVKADSPYKTLDDLVKALKKDPGSVVIGSGGTVGSQDWMQTALIAKAAGINP
RELRYVALEGGGEIATALLGGHIQVGSTDISDSMPHILSGDMRLLAVFSEQRLDEPEMKD
IPTAKEQGYDIVWPVVRGFYLGPKVSDADYAWWKDAFDKLLASDEFAKLRDQRELFPFAM
TGPELDTYVKKQVADYKVLAKEFGLIQ
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory