Comparing GFF1479 FitnessBrowser__Phaeo:GFF1479 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q92R43 Aquaglyceroporin AqpS from Rhizobium meliloti (strain 1021) (Ensifer meliloti) (Sinorhizobium meliloti) (see paper)
53% identity, 99% coverage: 3:218/218 of query aligns to 7:220/233 of Q92R43
P08995 Nodulin-26; N-26 from Glycine max (Soybean) (Glycine hispida) (see paper)
39% identity, 63% coverage: 4:141/218 of query aligns to 38:173/271 of P08995
Sites not aligning to the query:
Q9SAI4 Aquaporin NIP6-1; NOD26-like intrinsic protein 6-1; AtNIP6;1 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
33% identity, 62% coverage: 4:139/218 of query aligns to 80:212/305 of Q9SAI4
Sites not aligning to the query:
Q6Z2T3 Aquaporin NIP2-1; Low silicon protein 1; NOD26-like intrinsic protein 2-1; OsNIP2;1; Silicon influx transporter LSI1 from Oryza sativa subsp. japonica (Rice) (see paper)
31% identity, 85% coverage: 4:189/218 of query aligns to 49:237/298 of Q6Z2T3
O94778 Aquaporin-8; AQP-8 from Homo sapiens (Human) (see 4 papers)
43% identity, 44% coverage: 4:98/218 of query aligns to 36:124/261 of O94778
Sites not aligning to the query:
3nkaA Crystal structure of aqpz h174g,t183f (see paper)
37% identity, 43% coverage: 4:97/218 of query aligns to 5:96/230 of 3nkaA
Sites not aligning to the query:
P60844 Aquaporin Z; Bacterial nodulin-like intrinsic protein; Water channel AqpZ from Escherichia coli (strain K12) (see paper)
37% identity, 43% coverage: 4:97/218 of query aligns to 3:94/231 of P60844
Sites not aligning to the query:
2o9eA Crystal structure of aqpz mutant t183c complexed with mercury (see paper)
37% identity, 43% coverage: 4:97/218 of query aligns to 5:96/232 of 2o9eA
Sites not aligning to the query:
P30302 Aquaporin PIP2-3; Plasma membrane intrinsic protein 2-3; AtPIP2;3; Plasma membrane intrinsic protein 2c; PIP2c; RD28-PIP; TMP2C; Water stress-induced tonoplast intrinsic protein; WSI-TIP from Arabidopsis thaliana (Mouse-ear cress) (see paper)
29% identity, 69% coverage: 4:153/218 of query aligns to 37:201/285 of P30302
Sites not aligning to the query:
I1CR68 Aquaporin-1 from Rhizopus delemar (strain RA 99-880 / ATCC MYA-4621 / FGSC 9543 / NRRL 43880) (Mucormycosis agent) (Rhizopus arrhizus var. delemar) (see paper)
27% identity, 62% coverage: 4:138/218 of query aligns to 59:191/306 of I1CR68
Sites not aligning to the query:
P43287 Aquaporin PIP2-2; Plasma membrane intrinsic protein 2-2; AtPIP2;2; Plasma membrane intrinsic protein 2b; PIP2b; TMP2b from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
29% identity, 69% coverage: 4:153/218 of query aligns to 37:201/285 of P43287
Sites not aligning to the query:
P43286 Aquaporin PIP2-1; Plasma membrane intrinsic protein 2-1; AtPIP2;1; Plasma membrane intrinsic protein 2a; PIP2a from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
29% identity, 69% coverage: 4:153/218 of query aligns to 39:203/287 of P43286
Sites not aligning to the query:
P55064 Aquaporin-5; AQP-5 from Homo sapiens (Human) (see 2 papers)
31% identity, 65% coverage: 39:179/218 of query aligns to 42:198/265 of P55064
Sites not aligning to the query:
5dyeD Crystal structure of the full length s156e mutant of human aquaporin 5 (see paper)
31% identity, 65% coverage: 39:179/218 of query aligns to 41:197/253 of 5dyeD
P47863 Aquaporin-4; AQP-4; Mercurial-insensitive water channel; MIWC; WCH4 from Rattus norvegicus (Rat) (see 4 papers)
32% identity, 51% coverage: 47:158/218 of query aligns to 78:193/323 of P47863
Sites not aligning to the query:
P09011 Lens fiber major intrinsic protein; Aquaporin-0; MIP26; MP26 from Rattus norvegicus (Rat) (see 2 papers)
44% identity, 28% coverage: 37:98/218 of query aligns to 37:98/261 of P09011
Sites not aligning to the query:
P55088 Aquaporin-4; AQP-4; Mercurial-insensitive water channel; MIWC; WCH4 from Mus musculus (Mouse) (see 2 papers)
31% identity, 51% coverage: 47:158/218 of query aligns to 78:193/323 of P55088
Sites not aligning to the query:
P23645 Neurogenic protein big brain from Drosophila melanogaster (Fruit fly) (see 3 papers)
33% identity, 46% coverage: 39:139/218 of query aligns to 99:196/696 of P23645
Sites not aligning to the query:
6f7hC Crystal structure of human aqp10 (see paper)
27% identity, 60% coverage: 4:133/218 of query aligns to 7:134/253 of 6f7hC
Sites not aligning to the query:
P37451 Propanediol uptake facilitator PduF from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
33% identity, 53% coverage: 8:123/218 of query aligns to 11:123/264 of P37451
Sites not aligning to the query:
>GFF1479 FitnessBrowser__Phaeo:GFF1479
MTTQKLIAEALGTGFLLIGVVGSGIMAETLSGGNIGLALLANAVATGAMLYVIITTLGPI
SGAHFNPAVTLAFALRGDHSWAAVPPYVAAQIIGGILGVWASHVMFDLTILQTSTTMHRT
GGAQWFSEILATFGLLFVIFGGLRSRPEAVPALVAFYITGAYWFTASTSFANPAVTVARG
FSDTFAGIYPGHILMFIVMQFIGVGLAHLILPRLFRPS
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory