SitesBLAST
Comparing GFF1614 FitnessBrowser__Marino:GFF1614 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7vw6B Cryo-em structure of formate dehydrogenase 1 from methylorubrum extorquens am1 (see paper)
57% identity, 95% coverage: 16:558/571 of query aligns to 21:554/560 of 7vw6B
- binding fe2/s2 (inorganic) cluster: C108 (= C108), T112 (≠ S112), C113 (= C113), C141 (= C141), L144 (≠ R144), C145 (= C145)
- binding flavin mononucleotide: G221 (= G221), G223 (= G223), K232 (= K232), N248 (= N248), D250 (= D250), Y324 (= Y328), G327 (= G331), E328 (= E332), N363 (= N367), N364 (= N368), T367 (= T371)
- binding iron/sulfur cluster: I325 (= I329), P343 (= P347), S496 (= S500), C497 (= C501), G498 (= G502), Q499 (= Q503), C500 (= C504), C503 (= C507), I536 (= I540), C537 (= C541), L539 (= L543), G540 (= G544)
8a6tB Cryo-em structure of the electron bifurcating fe-fe hydrogenase hydabc complex from thermoanaerobacter kivui in the reduced state (see paper)
42% identity, 66% coverage: 187:561/571 of query aligns to 167:554/630 of 8a6tB
- binding flavin mononucleotide: G201 (= G223), N227 (= N248), E230 (= E251), N355 (= N368), G535 (= G542), L536 (= L543)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: S320 (≠ E333), R337 (= R350), R340 (≠ F353), T341 (≠ V354), N342 (≠ A355), S433 (= S446)
- binding iron/sulfur cluster: S487 (= S500), C488 (= C501), G489 (= G502), C491 (= C504), C494 (= C507), C534 (= C541), L536 (= L543), G537 (= G544)
- binding zinc ion: C471 (≠ D484)
Sites not aligning to the query:
- binding fe2/s2 (inorganic) cluster: 31, 33, 36, 82, 85, 86
- binding iron/sulfur cluster: 575, 577, 582, 583, 585, 588, 592, 596, 597, 607, 612, 618, 622, 624, 626, 627
- binding zinc ion: 558, 564
7q4vB Electron bifurcating hydrogenase - hydabc from a. Woodii (see paper)
37% identity, 80% coverage: 105:561/571 of query aligns to 8:523/599 of 7q4vB
- binding fe2/s2 (inorganic) cluster: C11 (= C108), C16 (= C113), C48 (= C141), F49 (≠ M142), L51 (≠ R144), C52 (= C145)
- binding flavin mononucleotide: G166 (= G221), G168 (= G223), N196 (= N248), D198 (= D250), F284 (≠ Y328), G287 (= G331), E288 (= E332), E289 (= E333), N324 (= N368)
- binding iron/sulfur cluster: C457 (= C501), G458 (= G502), K459 (≠ Q503), C460 (= C504), C463 (= C507), C503 (= C541), G506 (= G544)
- binding zinc ion: C440 (≠ D484)
Sites not aligning to the query:
- binding iron/sulfur cluster: 544, 551, 552, 553, 554, 555, 556, 557, 561, 562, 574, 581, 583, 584, 585, 586, 587, 591, 593, 595
- binding zinc ion: 527, 533
6q9cB Crystal structure of aquifex aeolicus nadh-quinone oxidoreductase subunits nuoe and nuof bound to nadh under anaerobic conditions (see paper)
42% identity, 66% coverage: 185:561/571 of query aligns to 30:412/418 of 6q9cB
- binding flavin mononucleotide: G64 (= G221), G66 (= G223), K75 (= K232), N91 (= N248), D93 (= D250), E94 (= E251), G182 (= G331), E183 (= E332), E184 (= E333), V217 (= V366), N218 (= N367), N219 (= N368), T222 (= T371), G393 (= G542)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G66 (= G223), G67 (= G224), A68 (= A225), F70 (= F227), K75 (= K232), E94 (= E251), E96 (= E253), Y179 (= Y328), E184 (= E333), Y204 (≠ F353)
- binding iron/sulfur cluster: P198 (= P347), T345 (≠ S500), C346 (= C501), G347 (= G502), Q348 (= Q503), C349 (= C504), C352 (= C507), I391 (= I540), C392 (= C541), L394 (= L543), G395 (= G544)
7q5yC Structure of nadh:ubichinon oxidoreductase (complex i) of the hyperthermophilic eubacterium aquifex aeolicus
42% identity, 66% coverage: 185:561/571 of query aligns to 31:413/419 of 7q5yC
- binding flavin mononucleotide: G65 (= G221), G67 (= G223), K76 (= K232), N92 (= N248), E95 (= E251), Y180 (= Y328), G183 (= G331), E184 (= E332), V218 (= V366), N219 (= N367), N220 (= N368), T223 (= T371)
- binding iron/sulfur cluster: T346 (≠ S500), C347 (= C501), G348 (= G502), Q349 (= Q503), C350 (= C504), C353 (= C507), S391 (= S539), I392 (= I540), C393 (= C541), G396 (= G544)
6saqB Wild-type nuoef from aquifex aeolicus bound to nadh-oh (see paper)
42% identity, 66% coverage: 185:561/571 of query aligns to 30:412/419 of 6saqB
- binding flavin mononucleotide: G64 (= G221), G66 (= G223), K75 (= K232), N91 (= N248), D93 (= D250), E94 (= E251), Y179 (= Y328), G182 (= G331), E183 (= E332), N218 (= N367), N219 (= N368), T222 (= T371)
- binding [[(2~{R},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl] [(2~{R},3~{S},4~{R},5~{R})-5-[[(1~{E},3~{Z})-5-azanyl-4-oxidanyl-5-oxidanylidene-penta-1,3-dienyl]-methanoyl-amino]-3,4-bis(oxidanyl)oxolan-2-yl]methyl hydrogen phosphate: G66 (= G223), G67 (= G224), A68 (= A225), F70 (= F227), K75 (= K232), E94 (= E251), E96 (= E253), T99 (= T256), E184 (= E333), Y204 (≠ F353), T318 (≠ S473)
- binding iron/sulfur cluster: P198 (= P347), T345 (≠ S500), C346 (= C501), G347 (= G502), Q348 (= Q503), C349 (= C504), C352 (= C507), I391 (= I540), C392 (= C541), G395 (= G544)
6hl3B Wild-type nuoef from aquifex aeolicus - oxidized form bound to NAD+ (see paper)
42% identity, 66% coverage: 185:561/571 of query aligns to 29:411/416 of 6hl3B
- binding flavin mononucleotide: G63 (= G221), G65 (= G223), K74 (= K232), N90 (= N248), D92 (= D250), E93 (= E251), G181 (= G331), E182 (= E332), E183 (= E333), V216 (= V366), N217 (= N367), N218 (= N368), T221 (= T371)
- binding nicotinamide-adenine-dinucleotide: G65 (= G223), G66 (= G224), A67 (= A225), F69 (= F227), K74 (= K232), E95 (= E253), Y178 (= Y328), E183 (= E333), K200 (≠ R350), Y203 (≠ F353)
- binding iron/sulfur cluster: I179 (= I329), P197 (= P347), T344 (≠ S500), C345 (= C501), G346 (= G502), Q347 (= Q503), C348 (= C504), C351 (= C507), S389 (= S539), I390 (= I540), C391 (= C541), L393 (= L543), G394 (= G544)
7q4vF Electron bifurcating hydrogenase - hydabc from a. Woodii (see paper)
45% identity, 59% coverage: 227:561/571 of query aligns to 43:394/470 of 7q4vF
- binding flavin mononucleotide: N67 (= N248), G158 (= G331), E159 (= E332), E160 (= E333), G375 (= G542)
- binding nicotinamide-adenine-dinucleotide: F43 (= F227), K48 (= K232), R177 (= R350), F180 (= F353), M297 (≠ F470)
- binding iron/sulfur cluster: S327 (= S500), C328 (= C501), G329 (= G502), K330 (≠ Q503), C331 (= C504), C334 (= C507), L373 (≠ I540), C374 (= C541)
- binding zinc ion: C311 (≠ D484)
Sites not aligning to the query:
- binding flavin mononucleotide: 37, 39
- binding nicotinamide-adenine-dinucleotide: 40
- binding iron/sulfur cluster: 415, 417, 422, 424, 425, 426, 427, 428, 432, 433, 437, 445, 452, 454, 455, 456, 457, 458, 462, 463, 467
- binding zinc ion: 398, 404, 409
8a5eB Cryo-em structure of the electron bifurcating fe-fe hydrogenase hydabc complex from acetobacterium woodii in the reduced state (see paper)
45% identity, 59% coverage: 227:561/571 of query aligns to 20:371/447 of 8a5eB
- binding flavin mononucleotide: N44 (= N248), G135 (= G331), E137 (= E333), N171 (= N367), N172 (= N368), G352 (= G542)
- binding 1,4-dihydronicotinamide adenine dinucleotide: F20 (= F227), K25 (= K232), F28 (≠ A235), D49 (≠ E253), R154 (= R350), F157 (= F353), S250 (= S446)
- binding iron/sulfur cluster: P151 (= P347), C305 (= C501), G306 (= G502), K307 (≠ Q503), C308 (= C504), C311 (= C507), C351 (= C541), G354 (= G544)
- binding zinc ion: C288 (≠ D484)
Sites not aligning to the query:
- binding flavin mononucleotide: 14, 16
- binding 1,4-dihydronicotinamide adenine dinucleotide: 16, 17
- binding iron/sulfur cluster: 392, 399, 401, 402, 403, 405, 409, 410, 414, 429, 431, 432, 433, 435, 439, 440, 444
- binding zinc ion: 375, 381, 386
7o6yB Cryo-em structure of respiratory complex i under turnover (see paper)
43% identity, 62% coverage: 210:565/571 of query aligns to 46:422/457 of 7o6yB
- binding flavin mononucleotide: G57 (= G221), G59 (= G223), K68 (= K232), N89 (= N248), D91 (= D250), E92 (= E251), G180 (= G331), E181 (= E332), E182 (= E333), T216 (≠ N367), N217 (= N368)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G59 (= G223), G60 (= G224), F63 (= F227), K68 (= K232), E94 (= E253), Y177 (= Y328), E182 (= E333), F202 (= F353), T324 (≠ S473)
- binding iron/sulfur cluster: P196 (= P347), S351 (= S500), C352 (= C501), G353 (= G502), Q354 (= Q503), C355 (= C504), C358 (= C507), T396 (≠ S539), C398 (= C541), L400 (= L543)
7b0nF 3.7-angstrom structure of Yarrowia lipolytica complex I with an R121M mutation in NUCM. (see paper)
43% identity, 62% coverage: 210:565/571 of query aligns to 47:423/460 of 7b0nF
- binding flavin mononucleotide: G60 (= G223), K69 (= K232), N90 (= N248), D92 (= D250), E93 (= E251), G94 (= G252), Y178 (= Y328), G181 (= G331), E182 (= E332), N218 (= N368)
- binding iron/sulfur cluster: P197 (= P347), S352 (= S500), C353 (= C501), Q355 (= Q503), C356 (= C504), C359 (= C507), T397 (≠ S539), C399 (= C541)
7t30B Structure of electron bifurcating ni-fe hydrogenase complex hydabcsl in fmn/NAD(h) bound state (see paper)
41% identity, 67% coverage: 183:565/571 of query aligns to 17:413/425 of 7t30B
- binding fe2/s2 (inorganic) cluster: C326 (≠ D484), C364 (≠ T522), H413 (≠ Q565)
- binding flavin mononucleotide: G54 (= G221), G56 (= G223), K65 (= K232), N82 (= N248), D84 (= D250), E85 (= E251), G173 (= G331), E175 (= E333), N210 (= N368), G390 (= G542), L391 (= L543)
- binding nicotinamide-adenine-dinucleotide: G56 (= G223), G57 (= G224), A58 (= A225), F60 (= F227), K65 (= K232), F68 (vs. gap), E85 (= E251), E175 (= E333), R192 (= R350), F195 (= F353), I312 (≠ F470), M313 (≠ I471), S315 (= S473)
- binding iron/sulfur cluster: S342 (= S500), C343 (= C501), G344 (= G502), C346 (= C504), C349 (= C507), S387 (= S539), C389 (= C541), L391 (= L543), G392 (= G544)
Sites not aligning to the query:
7t2rB Structure of electron bifurcating ni-fe hydrogenase complex hydabcsl in fmn-free apo state (see paper)
41% identity, 67% coverage: 183:565/571 of query aligns to 17:413/425 of 7t2rB
Sites not aligning to the query:
7p8nB Tmhydabc- t. Maritima hydrogenase with bridge closed (see paper)
35% identity, 80% coverage: 103:561/571 of query aligns to 26:540/613 of 7p8nB
- binding fe2/s2 (inorganic) cluster: C31 (= C108), G33 (≠ S110), T34 (≠ L111), C36 (= C113), C67 (= C141), C68 (≠ M142), G69 (= G143), R70 (= R144), C71 (= C145)
- binding flavin mononucleotide: G185 (= G221), R186 (≠ L222), G187 (= G223), N213 (= N248), D215 (= D250), E216 (= E251), G217 (= G252), F301 (≠ Y328), G304 (= G331), E305 (= E332), E306 (= E333), N340 (= N367), N341 (= N368), G521 (= G542), L522 (= L543)
- binding iron/sulfur cluster: P320 (= P347), S473 (= S500), C474 (= C501), G475 (= G502), K476 (≠ Q503), C477 (= C504), C480 (= C507), L519 (≠ I540), C520 (= C541), L522 (= L543), G523 (= G544)
- binding zinc ion: C457 (≠ D484)
Sites not aligning to the query:
- binding iron/sulfur cluster: 560, 567, 570, 571, 573, 577, 590, 592, 597, 599, 600, 601, 603, 607
- binding zinc ion: 544, 549, 554
8b9zF Drosophila melanogaster complex i in the active state (dm1) (see paper)
44% identity, 62% coverage: 208:562/571 of query aligns to 56:428/441 of 8b9zF
- binding flavin mononucleotide: G69 (= G221), G71 (= G223), K80 (= K232), N98 (= N248), D100 (= D250), G189 (= G331), E191 (= E333), N226 (= N368), A408 (≠ G542), L409 (= L543)
- binding iron/sulfur cluster: P205 (= P347), C361 (= C501), G362 (= G502), Q363 (= Q503), C364 (= C504), C367 (= C507), T405 (≠ S539), C407 (= C541), L409 (= L543)
8eswV1 NADH dehydrogenase (Ubiquinone) 24 kDa subunit, isoform A (see paper)
44% identity, 62% coverage: 208:562/571 of query aligns to 54:426/439 of 8eswV1
- binding flavin mononucleotide: G67 (= G221), G69 (= G223), K78 (= K232), N96 (= N248), D98 (= D250), E99 (= E251), G187 (= G331), E188 (= E332), N224 (= N368), A406 (≠ G542)
- binding iron/sulfur cluster: I185 (= I329), P203 (= P347), C359 (= C501), Q361 (= Q503), C362 (= C504), C365 (= C507), T403 (≠ S539), I404 (= I540), C405 (= C541), L407 (= L543)
- binding : Y143 (≠ P295), N144 (≠ G296), Q150 (≠ K302), D174 (vs. gap)
7zm7B Cryoem structure of mitochondrial complex i from chaetomium thermophilum (inhibited by ddm) (see paper)
42% identity, 68% coverage: 177:565/571 of query aligns to 23:424/456 of 7zm7B
- binding flavin mononucleotide: G59 (= G221), G61 (= G223), K70 (= K232), N91 (= N248), D93 (= D250), G182 (= G331), E183 (= E332), E184 (= E333), A218 (≠ N367), N219 (= N368), A401 (≠ G542), L402 (= L543)
- binding iron/sulfur cluster: P198 (= P347), C354 (= C501), G355 (= G502), Q356 (= Q503), C357 (= C504), C360 (= C507), T398 (≠ S539), C400 (= C541), L402 (= L543)
8oh5B Cryo-em structure of the electron bifurcating transhydrogenase stnabc complex from sporomusa ovata (state 2) (see paper)
41% identity, 67% coverage: 180:561/571 of query aligns to 113:508/584 of 8oh5B
- binding flavin mononucleotide: R154 (≠ L222), K164 (= K232), N181 (= N248), F269 (≠ Y328), E273 (= E332), E274 (= E333), I307 (≠ V366), N308 (= N367), N309 (= N368), G489 (= G542), L490 (= L543)
- binding nicotinamide-adenine-dinucleotide: G155 (= G223), G156 (= G224), F159 (= F227), F163 (≠ R231), E273 (= E332), E274 (= E333), K291 (≠ R350), F294 (= F353), G413 (= G472)
- binding iron/sulfur cluster: P288 (= P347), C442 (= C501), G443 (= G502), C445 (= C504), C448 (= C507), C488 (= C541), L490 (= L543), G491 (= G544)
- binding zinc ion: C425 (≠ D484)
Sites not aligning to the query:
- binding fe2/s2 (inorganic) cluster: 10, 41, 45
- binding iron/sulfur cluster: 531, 536, 540, 542, 546, 547, 548, 559, 566, 567, 568, 569, 572
- binding zinc ion: 512, 518, 523
P49821 NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial; NDUFV1; Complex I-51kD; CI-51kD; NADH dehydrogenase flavoprotein 1; NADH-ubiquinone oxidoreductase 51 kDa subunit; EC 7.1.1.2 from Homo sapiens (Human) (see paper)
44% identity, 62% coverage: 208:562/571 of query aligns to 74:446/464 of P49821
- C379 (= C501) binding
- C382 (= C504) binding
- C385 (= C507) binding
- C425 (= C541) binding
7dgq8 NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial (see paper)
44% identity, 62% coverage: 208:562/571 of query aligns to 43:415/427 of 7dgq8
- binding flavin mononucleotide: G58 (= G223), K67 (= K232), N85 (= N248), D87 (= D250), E88 (= E251), G89 (= G252), C175 (= C330), G176 (= G331), A212 (≠ N367), N213 (= N368)
- binding iron/sulfur cluster: S347 (= S500), C348 (= C501), G349 (= G502), C351 (= C504), C354 (= C507), C394 (= C541), L396 (= L543)
- binding : R121 (≠ Q284), Y132 (≠ P295), Q139 (≠ K302), R143 (≠ A306), Y146 (≠ E309), E147 (≠ T310), F165 (≠ I320), R168 (= R323)
Query Sequence
>GFF1614 FitnessBrowser__Marino:GFF1614
MKTDEQKVKRRRSGLRGRQLEPTVLSGLRELIGDERVDSSLRHRDRLIEHLHLIQDADGY
LSMARLRALASFMNLPMADVYETATFYAHFDVVHDEQTPPPAITLRVCDSLSCQLAGASA
LHKTLADGTDPAQVRVVHAPCMGRCDTAPVVAVGHHHVGNATAETVGAAVEQQQVQPDEI
HWQKLADYRSAGGYQLLKDCREGRVTVDSLAEELEHAGLRGLGGAGFPTYRKWQAVRAEP
GPRYAVINADEGEPGTFKDRYYLEREPHGFLEGALVSAWAVEAQALYIYLRDEYPGLLVV
LKDAIAELETAGIVEPGFVILRRGAGAYICGEESALIESLEGKPGKPRHRPPFVAQKGLF
GQPTLVNNVETVYWIPRIHAQGAEWYASQGRHGRKGLRSFSVSGRVARPGVHVAPAGVTL
NELIEEYCGGMAEGHRLVAYLPGGASGGILPASKADIPLDFDTLQEHGCFIGSAAVIVLS
DQDDLQAAAANLLGFFADESCGQCTPCRVGTEKMLTLLERDTWDEQTLQQLAAVMADASI
CGLGQAAPNPVLSLLRDFRSELASQNLIAKG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory