SitesBLAST
Comparing GFF1615 FitnessBrowser__Phaeo:GFF1615 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2ef5A Crystal structure of the arginase from thermus thermophilus
42% identity, 95% coverage: 10:302/310 of query aligns to 5:273/273 of 2ef5A
- active site: H80 (= H100), D102 (= D127), H104 (= H129), D106 (= D131), H118 (= H144), D200 (= D229), D202 (= D231), E245 (= E274)
- binding lysine: P9 (= P14), D15 (≠ L25), M16 (= M26), S19 (≠ D29)
- binding manganese (ii) ion: H80 (= H100), D102 (= D127), D102 (= D127), H104 (= H129), D106 (= D131), D200 (= D229), D200 (= D229), D202 (= D231)
P78540 Arginase-2, mitochondrial; Arginase II; Kidney-type arginase; Non-hepatic arginase; Type II arginase; EC 3.5.3.1 from Homo sapiens (Human) (see paper)
38% identity, 96% coverage: 1:299/310 of query aligns to 19:325/354 of P78540
6q39A Complex of arginase 2 with example 49 (see paper)
39% identity, 94% coverage: 10:299/310 of query aligns to 5:302/306 of 6q39A
- active site: H97 (= H100), D120 (= D127), H122 (= H129), D124 (= D131), H137 (= H144), D228 (= D229), D230 (= D231), E273 (= E274)
- binding 3-[(3~{S},4~{R})-4-azanyl-4-carboxy-1-[[(2~{S})-piperidin-2-yl]methyl]pyrrolidin-3-yl]propyl-tris(oxidanyl)boranuide: H97 (= H100), D120 (= D127), H122 (= H129), D124 (= D131), N126 (≠ H133), S133 (= S140), H137 (= H144), D177 (≠ S179), D179 (= D181), D228 (= D229), T242 (= T243), E273 (= E274)
- binding manganese (ii) ion: H97 (= H100), D120 (= D127), D120 (= D127), H122 (= H129), D124 (= D131), D228 (= D229), D228 (= D229), D230 (= D231)
6q37A Complex of arginase 2 with example 23 (see paper)
39% identity, 94% coverage: 10:299/310 of query aligns to 5:302/306 of 6q37A
- active site: H97 (= H100), D120 (= D127), H122 (= H129), D124 (= D131), H137 (= H144), D228 (= D229), D230 (= D231), E273 (= E274)
- binding 3-[(3~{S},4~{R})-4-azanyl-4-carboxy-pyrrolidin-3-yl]propyl-tris(oxidanyl)boranuide: H97 (= H100), D120 (= D127), H122 (= H129), D124 (= D131), N126 (≠ H133), S133 (= S140), H137 (= H144), G138 (= G145), D179 (= D181), D228 (= D229)
- binding manganese (ii) ion: H97 (= H100), D120 (= D127), D120 (= D127), H122 (= H129), D124 (= D131), D228 (= D229), D228 (= D229), D230 (= D231)
4ixvA Crystal structure of human arginase-2 complexed with inhibitor 2d: {(5r)-5-amino-5-carboxy-5-[1-(4-chlorobenzyl)piperidin-4- yl]pentyl}(trihydroxy)borate(1-) (see paper)
39% identity, 94% coverage: 10:299/310 of query aligns to 5:302/306 of 4ixvA
- active site: H97 (= H100), D120 (= D127), H122 (= H129), D124 (= D131), H137 (= H144), D228 (= D229), D230 (= D231), E273 (= E274)
- binding manganese (ii) ion: H97 (= H100), D120 (= D127), D120 (= D127), H122 (= H129), D124 (= D131), D228 (= D229), D228 (= D229), D230 (= D231)
- binding {(5R)-5-amino-5-carboxy-5-[1-(4-chlorobenzyl)piperidin-4-yl]pentyl}(trihydroxy)borate(1-): D120 (= D127), H122 (= H129), D124 (= D131), S132 (≠ D139), S133 (= S140), H137 (= H144), G138 (= G145), D179 (= D181), D228 (= D229), E273 (= E274)
4ixuA Crystal structure of human arginase-2 complexed with inhibitor 11d: {(5r)-5-amino-5-carboxy-5-[(3-endo)-8-(3,4-dichlorobenzyl)-8- azabicyclo[3.2.1]oct-3-yl]pentyl}(trihydroxy)borate(1-) (see paper)
39% identity, 94% coverage: 10:299/310 of query aligns to 5:302/306 of 4ixuA
- active site: H97 (= H100), D120 (= D127), H122 (= H129), D124 (= D131), H137 (= H144), D228 (= D229), D230 (= D231), E273 (= E274)
- binding {(5R)-5-amino-5-carboxy-5-[(3-endo)-8-(3,4-dichlorobenzyl)-8-azabicyclo[3.2.1]oct-3-yl]pentyl}(trihydroxy)borate(1-): D120 (= D127), H122 (= H129), D124 (= D131), N126 (≠ H133), S133 (= S140), H137 (= H144), G138 (= G145), D179 (= D181), D228 (= D229)
- binding manganese (ii) ion: H97 (= H100), D120 (= D127), D120 (= D127), H122 (= H129), D124 (= D131), D228 (= D229), D228 (= D229), D230 (= D231)
4ie3A Crystal structure of human arginase-2 complexed with inhbitor 1o (see paper)
39% identity, 94% coverage: 10:299/310 of query aligns to 5:302/306 of 4ie3A
- active site: H97 (= H100), D120 (= D127), H122 (= H129), D124 (= D131), H137 (= H144), D228 (= D229), D230 (= D231), E273 (= E274)
- binding [(5R)-5-amino-5-carboxy-7-(4-hydroxypiperidin-1-yl)heptyl](trihydroxy)borate(1-): D120 (= D127), H122 (= H129), D124 (= D131), N126 (≠ H133), S133 (= S140), H137 (= H144), D179 (= D181), D228 (= D229)
- binding manganese (ii) ion: H97 (= H100), D120 (= D127), D120 (= D127), H122 (= H129), D124 (= D131), D228 (= D229), D228 (= D229), D230 (= D231)
4ie2A Crystal structure of human arginase-2 complexed with inhibitor 1h (see paper)
39% identity, 94% coverage: 10:299/310 of query aligns to 5:302/306 of 4ie2A
- active site: H97 (= H100), D120 (= D127), H122 (= H129), D124 (= D131), H137 (= H144), D228 (= D229), D230 (= D231), E273 (= E274)
- binding [(5R)-5-amino-5-carboxy-8-hydroxyoctyl](trihydroxy)borate(1-): H97 (= H100), D120 (= D127), H122 (= H129), D124 (= D131), S133 (= S140), H137 (= H144), G138 (= G145), D179 (= D181), D228 (= D229)
- binding manganese (ii) ion: H97 (= H100), D120 (= D127), D120 (= D127), H122 (= H129), D124 (= D131), D228 (= D229), D228 (= D229), D230 (= D231)
4i06A Crystal structure of human arginase-2 complexed with inhibitor 14 (see paper)
39% identity, 94% coverage: 10:299/310 of query aligns to 5:302/306 of 4i06A
- active site: H97 (= H100), D120 (= D127), H122 (= H129), D124 (= D131), H137 (= H144), D228 (= D229), D230 (= D231), E273 (= E274)
- binding manganese (ii) ion: H97 (= H100), D120 (= D127), D120 (= D127), H122 (= H129), D124 (= D131), D228 (= D229), D228 (= D229), D230 (= D231)
- binding [(5R)-5-carboxy-5-(methylamino)-7-(piperidin-1-yl)heptyl](trihydroxy)borate(1-): H97 (= H100), D120 (= D127), H122 (= H129), D124 (= D131), S133 (= S140), H137 (= H144), G138 (= G145), D179 (= D181), D228 (= D229)
4hzeA Crystal structure of human arginase-2 complexed with inhibitor 9 (see paper)
39% identity, 94% coverage: 10:299/310 of query aligns to 5:302/306 of 4hzeA
- active site: H97 (= H100), D120 (= D127), H122 (= H129), D124 (= D131), H137 (= H144), D228 (= D229), D230 (= D231), E273 (= E274)
- binding manganese (ii) ion: H97 (= H100), D120 (= D127), D120 (= D127), H122 (= H129), D124 (= D131), D228 (= D229), D228 (= D229), D230 (= D231)
- binding [(5R)-5-amino-5-carboxy-7-(piperidin-1-yl)heptyl](trihydroxy)borate(1-): H97 (= H100), D120 (= D127), H122 (= H129), D124 (= D131), S133 (= S140), H137 (= H144), D179 (= D181), D228 (= D229)
1pq3A Human arginase ii: crystal structure and physiological role in male and female sexual arousal (see paper)
39% identity, 94% coverage: 10:299/310 of query aligns to 5:302/306 of 1pq3A
- active site: H97 (= H100), D120 (= D127), H122 (= H129), D124 (= D131), H137 (= H144), D228 (= D229), D230 (= D231), E273 (= E274)
- binding manganese (ii) ion: H97 (= H100), D120 (= D127), D120 (= D127), H122 (= H129), D124 (= D131), D228 (= D229), D228 (= D229), D230 (= D231)
- binding s-2-(boronoethyl)-l-cysteine: H122 (= H129), D124 (= D131), S133 (= S140), H137 (= H144), D179 (= D181), D228 (= D229), E273 (= E274)
6ss2AAA of arginase-2 in complex with the inhibitory human antigen-binding fragment fab c0021158' (see paper)
39% identity, 94% coverage: 10:299/310 of query aligns to 7:304/320 of 6ss2AAA
6nfpA 1.7 angstrom resolution crystal structure of arginase from bacillus subtilis subsp. Subtilis str. 168
38% identity, 96% coverage: 6:302/310 of query aligns to 1:292/292 of 6nfpA
6dktA Crystal structure of arginase from bacillus subtilis
38% identity, 96% coverage: 6:302/310 of query aligns to 1:283/283 of 6dktA
6nfpD 1.7 angstrom resolution crystal structure of arginase from bacillus subtilis subsp. Subtilis str. 168
38% identity, 96% coverage: 6:302/310 of query aligns to 4:289/289 of 6nfpD
1cevA Arginase from bacillus caldovelox, native structure at ph 5.6 (see paper)
37% identity, 96% coverage: 6:302/310 of query aligns to 2:299/299 of 1cevA
- active site: H99 (= H100), D122 (= D127), H124 (= H129), D126 (= D131), H139 (= H144), D226 (= D229), D228 (= D231), E271 (= E274)
- binding manganese (ii) ion: H99 (= H100), D122 (= D127), D122 (= D127), H124 (= H129), D126 (= D131), D226 (= D229), D226 (= D229), D228 (= D231)
P53608 Arginase; EC 3.5.3.1 from Bacillus caldovelox (see paper)
37% identity, 96% coverage: 6:302/310 of query aligns to 2:299/299 of P53608
5cevA Arginase from bacillus caldevelox, l-lysine complex (see paper)
37% identity, 96% coverage: 6:302/310 of query aligns to 1:298/298 of 5cevA
- active site: H98 (= H100), D121 (= D127), H123 (= H129), D125 (= D131), H138 (= H144), D225 (= D229), D227 (= D231), E270 (= E274)
- binding guanidine: H251 (= H255), E255 (= E259)
- binding lysine: S134 (= S140), H138 (= H144), E270 (= E274)
- binding manganese (ii) ion: H98 (= H100), D121 (= D127), D121 (= D127), H123 (= H129), D125 (= D131), D225 (= D229), D225 (= D229), D227 (= D231)
4cevA Arginase from bacillus caldevelox, l-ornithine complex (see paper)
37% identity, 96% coverage: 6:302/310 of query aligns to 1:298/298 of 4cevA
- active site: H98 (= H100), D121 (= D127), H123 (= H129), D125 (= D131), H138 (= H144), D225 (= D229), D227 (= D231), E270 (= E274)
- binding guanidine: H251 (= H255), E255 (= E259)
- binding manganese (ii) ion: H98 (= H100), D121 (= D127), D121 (= D127), H123 (= H129), D125 (= D131), D225 (= D229), D225 (= D229), D227 (= D231)
- binding L-ornithine: H123 (= H129), D125 (= D131), S134 (= S140), H138 (= H144), D177 (= D181)
3cevA Arginase from bacillus caldevelox, complexed with l-arginine (see paper)
37% identity, 96% coverage: 6:302/310 of query aligns to 1:298/298 of 3cevA
- active site: H98 (= H100), D121 (= D127), H123 (= H129), D125 (= D131), H138 (= H144), D225 (= D229), D227 (= D231), E270 (= E274)
- binding arginine: H123 (= H129), D125 (= D131), S134 (= S140), H138 (= H144), D225 (= D229), H251 (= H255), E255 (= E259), E270 (= E274), E295 (≠ R299), L297 (≠ V301)
- binding manganese (ii) ion: H98 (= H100), D121 (= D127), D125 (= D131), D225 (= D229)
Query Sequence
>GFF1615 FitnessBrowser__Phaeo:GFF1615
MRVTSKTCILIGAPVDSGKRRAGCLMGPDAYRTAGLGRAIESLGHKVIDQGNLRPATHEP
DTNDGLVFARNETIGWTNRLIRAAEEAMKDGLPIFLGGDHSLSLGSVVGVANHAAKEGRP
QFVLWLDAHTDFHTPATSDSGNLHGTPVGYFTGRPDFAGFPEVANPVPQENVCMIGLRSV
DTPERLALEASDIHRHDMRDIDENGIAGPLSAFLQRVKDANGMLHVSLDVDFLDPSVAPA
VGTTVPGGATVREGHLVCEMLHDSGLMTSLDLVELNPFLDERGRTAHLMVDLCASALGRR
VFDRPTRSYQ
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory