SitesBLAST
Comparing GFF1627 FitnessBrowser__Marino:GFF1627 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
B3TMR8 dTDP-3,4-didehydro-2,6-dideoxy-alpha-D-glucose 3-reductase; 3-ketoreductase; NADPH-dependent C3-ketoreductase; EC 1.1.1.384 from Actinomadura kijaniata (see paper)
29% identity, 94% coverage: 1:326/348 of query aligns to 1:313/332 of B3TMR8
- 17:23 (vs. 13:19, 43% identical) binding
- SR 42:43 (= SR 37:38) binding
- Y63 (= Y59) binding
- L79 (≠ V75) binding
- H84 (≠ R80) binding
- K102 (= K98) active site, Proton donor; mutation K->A,M,Q: Loss of reductase activity.; mutation to E: Retains some activity, but the catalytic efficiency is strongly reduced.
- R170 (≠ W161) binding
- D182 (= D181) binding
- Y186 (= Y185) mutation to F: Same affinity for dTDP-glucose and NADPH compared to the wild-type. Small reduction of the catalytic efficiency resulting from the conformational flexibility of the nicotinamide ring.
3rc1A Crystal structure of kijd10, a 3-ketoreductase from actinomadura kijaniata incomplex with NADP and tdp-benzene (see paper)
29% identity, 92% coverage: 6:326/348 of query aligns to 3:306/325 of 3rc1A
- active site: K95 (= K98), Y179 (= Y185)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: C10 (≠ T13), A11 (= A14), D12 (≠ E15), I13 (= I16), S35 (= S37), R36 (= R38), Y56 (= Y59), P71 (= P74), L72 (≠ V75), P73 (= P76), H77 (≠ R80), E94 (= E97), K95 (= K98), I162 (≠ E160), R163 (≠ W161), V168 (≠ N166), D175 (= D181), Y179 (= Y185)
- binding phosphate ion: H278 (vs. gap), K283 (= K303)
- binding 5'-O-[(S)-hydroxy{[(S)-hydroxy(phenoxy)phosphoryl]oxy}phosphoryl]thymidine: R16 (≠ K19), R17 (≠ V20), F152 (= F152), I154 (≠ F154), P155 (vs. gap), Y233 (≠ H240), T253 (= T276)
4koaA Crystal structure analysis of 1,5-anhydro-d-fructose reductase from sinorhizobium meliloti (see paper)
37% identity, 43% coverage: 6:156/348 of query aligns to 2:152/333 of 4koaA
- active site: K94 (= K98)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G8 (= G12), A9 (≠ T13), S10 (≠ A14), T11 (≠ E15), I12 (= I16), S33 (= S37), S34 (≠ R38), R38 (= R42), T71 (≠ V75), N73 (≠ T77), H76 (≠ R80), K94 (= K98)
Sites not aligning to the query:
2poqX Dimeric dihydrodiol dehydrogenase complexed with inhibitor, isoascorbic acid (see paper)
26% identity, 57% coverage: 6:204/348 of query aligns to 2:198/331 of 2poqX
Sites not aligning to the query:
2o4uX Crystal structure of mammalian dimeric dihydrodiol dehydrogenase (see paper)
26% identity, 57% coverage: 6:204/348 of query aligns to 2:198/331 of 2o4uX
- binding phosphate ion: L2 (≠ V6), S8 (≠ G12), V9 (≠ T13), A35 (≠ S37), R36 (= R38), R40 (= R42), Y57 (= Y59), N101 (vs. gap), A103 (≠ D102), D145 (= D144), R147 (= R146), K155 (vs. gap)
Sites not aligning to the query:
Q7JK39 Trans-1,2-dihydrobenzene-1,2-diol dehydrogenase; D-xylose 1-dehydrogenase; D-xylose-NADP dehydrogenase; Dimeric dihydrodiol dehydrogenase; Jmo2DD; EC 1.3.1.20; EC 1.1.1.179 from Macaca fuscata fuscata (Japanese macaque) (see paper)
26% identity, 57% coverage: 6:204/348 of query aligns to 3:199/334 of Q7JK39
- H79 (≠ R80) mutation to E: Decrease in K(d) and K(m) value for NADPH. Elimination of the fluorescence-energy transfer and enhancement of NADPH fluorescence by the binary complex formation. Potent inhibition of the dehydrogenase activity by high ionic strength.
- Y180 (= Y185) mutation to F: Significant loss of activity. No effect on the high affinity for NADPH, fluorescence-energy transfer and enhancement of NADPH fluorescence by the binary complex formation.
Q9TQS6 Trans-1,2-dihydrobenzene-1,2-diol dehydrogenase; Cmo2DD; D-xylose 1-dehydrogenase; D-xylose-NADP dehydrogenase; Dimeric dihydrodiol dehydrogenase; EC 1.3.1.20; EC 1.1.1.179 from Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey) (see paper)
26% identity, 57% coverage: 6:204/348 of query aligns to 3:199/334 of Q9TQS6
- R148 (= R146) mutation to A: No effect on activity. Reduced activity and exhibits significant temperature sensitivity; when associated with A-202.
Sites not aligning to the query:
- 202 R→A: No effect on activity. Reduced activity and exhibits significant temperature sensitivity; when associated with A-148.
5a06A Crystal structure of aldose-aldose oxidoreductase from caulobacter crescentus complexed with sorbitol (see paper)
26% identity, 56% coverage: 4:197/348 of query aligns to 2:198/336 of 5a06A
- active site: K101 (= K98), Y186 (= Y185)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: L11 (≠ T13), G12 (≠ A14), Y13 (≠ E15), Y14 (≠ I16), S36 (= S37), G37 (≠ R38), T38 (≠ S39), K41 (≠ R42), Y59 (≠ L56), I77 (≠ P74), T78 (≠ V75), P79 (= P76), N80 (≠ T77), L82 (= L79), H83 (≠ R80), E100 (= E97), K101 (= K98), R129 (≠ M123), W168 (= W161), R169 (= R168), Y186 (= Y185)
- binding sorbitol: R2 (= R4), D72 (= D69), H96 (= H93), K101 (= K98), R122 (≠ V116), R122 (≠ V116), L124 (≠ F118), F160 (= F152), R169 (= R168), D182 (= D181), Y186 (= Y185)
Sites not aligning to the query:
5a03C Crystal structure of aldose-aldose oxidoreductase from caulobacter crescentus complexed with xylose (see paper)
26% identity, 56% coverage: 4:197/348 of query aligns to 2:198/336 of 5a03C
- active site: K101 (= K98), Y186 (= Y185)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G10 (= G12), L11 (≠ T13), G12 (≠ A14), Y13 (≠ E15), Y14 (≠ I16), S36 (= S37), G37 (≠ R38), T38 (≠ S39), K41 (≠ R42), Y59 (≠ L56), I77 (≠ P74), T78 (≠ V75), P79 (= P76), N80 (≠ T77), L82 (= L79), H83 (≠ R80), E100 (= E97), K101 (= K98), R129 (≠ M123), W168 (= W161), R169 (= R168), Y186 (= Y185)
- binding beta-D-xylopyranose: K101 (= K98), F160 (= F152), R169 (= R168), D182 (= D181), Y186 (= Y185)
Sites not aligning to the query:
5a05A Crystal structure of aldose-aldose oxidoreductase from caulobacter crescentus complexed with maltotriose (see paper)
26% identity, 56% coverage: 4:197/348 of query aligns to 1:197/335 of 5a05A
- active site: K100 (= K98), Y185 (= Y185)
- binding beta-D-glucopyranose: K100 (= K98), F159 (= F152), D181 (= D181), Y185 (= Y185)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G9 (= G12), L10 (≠ T13), G11 (≠ A14), Y12 (≠ E15), Y13 (≠ I16), S35 (= S37), G36 (≠ R38), T37 (≠ S39), K40 (≠ R42), Y58 (≠ L56), I76 (≠ P74), T77 (≠ V75), P78 (= P76), N79 (≠ T77), L81 (= L79), H82 (≠ R80), E99 (= E97), K100 (= K98), R128 (≠ M123), W167 (= W161), R168 (= R168), Y185 (= Y185)
Sites not aligning to the query:
5a04A Crystal structure of aldose-aldose oxidoreductase from caulobacter crescentus complexed with glucose (see paper)
26% identity, 56% coverage: 4:197/348 of query aligns to 1:197/335 of 5a04A
- active site: K100 (= K98), Y185 (= Y185)
- binding beta-D-glucopyranose: K100 (= K98), F159 (= F152), R168 (= R168), D181 (= D181), Y185 (= Y185)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: L10 (≠ T13), G11 (≠ A14), Y12 (≠ E15), Y13 (≠ I16), S35 (= S37), G36 (≠ R38), T37 (≠ S39), K40 (≠ R42), Y58 (≠ L56), I76 (≠ P74), T77 (≠ V75), P78 (= P76), N79 (≠ T77), L81 (= L79), H82 (≠ R80), E99 (= E97), K100 (= K98), R128 (≠ M123), W167 (= W161), R168 (= R168), Y185 (= Y185)
Sites not aligning to the query:
5a03E Crystal structure of aldose-aldose oxidoreductase from caulobacter crescentus complexed with xylose (see paper)
26% identity, 56% coverage: 4:197/348 of query aligns to 1:197/335 of 5a03E
- active site: K100 (= K98), Y185 (= Y185)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G9 (= G12), L10 (≠ T13), G11 (≠ A14), Y12 (≠ E15), Y13 (≠ I16), S35 (= S37), G36 (≠ R38), T37 (≠ S39), K40 (≠ R42), Y58 (≠ L56), I76 (≠ P74), T77 (≠ V75), P78 (= P76), N79 (≠ T77), H82 (≠ R80), E99 (= E97), K100 (= K98), R128 (≠ M123), W167 (= W161), R168 (= R168), Y185 (= Y185)
- binding beta-D-xylopyranose: K100 (= K98), F159 (= F152), R168 (= R168), D181 (= D181), Y185 (= Y185)
- binding alpha-D-xylopyranose: H134 (≠ R129)
Sites not aligning to the query:
5a02A Crystal structure of aldose-aldose oxidoreductase from caulobacter crescentus complexed with glycerol (see paper)
26% identity, 56% coverage: 4:197/348 of query aligns to 1:197/335 of 5a02A
- active site: K100 (= K98), Y185 (= Y185)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: L10 (≠ T13), G11 (≠ A14), Y12 (≠ E15), Y13 (≠ I16), S35 (= S37), G36 (≠ R38), T37 (≠ S39), K40 (≠ R42), Y58 (≠ L56), I76 (≠ P74), T77 (≠ V75), P78 (= P76), L81 (= L79), H82 (≠ R80), E99 (= E97), K100 (= K98), R128 (≠ M123), W167 (= W161), R168 (= R168), Y185 (= Y185)
Sites not aligning to the query:
Q2I8V6 1,5-anhydro-D-fructose reductase; Anhydrofructose reductase; 1,5-anhydro-D-fructose reductase (1,5-anhydro-D-mannitol-forming); EC 1.1.1.292 from Ensifer adhaerens (Sinorhizobium morelense) (see paper)
35% identity, 43% coverage: 7:156/348 of query aligns to 3:152/333 of Q2I8V6
- ASTI 9:12 (≠ TAEI 13:16) binding
- S10 (≠ A14) mutation to G: Almost no effect.
- A13 (= A17) mutation to G: Can use NAD as cosubstrate as well as NADP.
- S33 (= S37) mutation to D: No activity.
- ST 33:34 (≠ SR 37:38) binding
- R38 (= R42) binding
- TTNELH 71:76 (≠ VPTALR 75:80) binding
- EK 93:94 (= EK 97:98) binding
- K94 (= K98) mutation to G: Less than 1% remaining activity.
- N120 (≠ G121) binding
Sites not aligning to the query:
- 162:163 binding
- 176 D→A: Less than 1% remaining activity.
- 180 H→A: Less than 2% remaining activity.
- 206 G→I: No effect.
- 283 binding
2glxA Crystal structure analysis of bacterial 1,5-af reductase (see paper)
35% identity, 43% coverage: 7:156/348 of query aligns to 2:151/332 of 2glxA
- active site: K93 (= K98)
- binding acetate ion: K93 (= K98)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G7 (= G12), A8 (≠ T13), S9 (≠ A14), T10 (≠ E15), I11 (= I16), S32 (= S37), T33 (≠ R38), R37 (= R42), S69 (≠ P74), T70 (≠ V75), N72 (≠ T77), H75 (≠ R80), E92 (= E97), K93 (= K98), H121 (≠ M123)
Sites not aligning to the query:
4n54A Crystal structure of scyllo-inositol dehydrogenase from lactobacillus casei with bound cofactor NAD(h) and scyllo-inositol
25% identity, 72% coverage: 4:255/348 of query aligns to 1:259/340 of 4n54A
- active site: K96 (= K98), H183 (≠ Y185)
- binding (1r,2r,3r,4r,5r,6r)-cyclohexane-1,2,3,4,5,6-hexol: R12 (≠ E15), K96 (= K98), D156 (≠ F154), D179 (= D181), M180 (≠ Q182), H183 (≠ Y185), R238 (≠ C236), Y244 (≠ S242)
- binding 1,4-dihydronicotinamide adenine dinucleotide: V8 (≠ I11), G9 (= G12), L10 (≠ T13), G11 (≠ A14), R12 (≠ E15), L13 (≠ I16), S35 (≠ A34), V36 (= V35), E40 (≠ S39), S73 (≠ V75), P74 (= P76), F77 (≠ L79), H78 (≠ R80), E95 (= E97), K96 (= K98), M125 (= M123), F167 (≠ T169)
Sites not aligning to the query:
6o15A Crystal structure of a putative oxidoreductase yjhc from escherichia coli in complex with NAD(h) (see paper)
25% identity, 72% coverage: 6:256/348 of query aligns to 2:252/355 of 6o15A
- binding nicotinamide-adenine-dinucleotide: G10 (≠ A14), Y11 (≠ E15), F12 (≠ I16), Y32 (≠ A36), D33 (≠ S37), A67 (≠ P74), T68 (≠ V75), P69 (= P76), N70 (≠ T77), H73 (≠ R80), E90 (= E97), K91 (= K98), I119 (≠ M123), W160 (vs. gap)
1rydA Crystal structure of glucose-fructose oxidoreductase from zymomonas mobilis
23% identity, 74% coverage: 2:260/348 of query aligns to 28:295/381 of 1rydA
- active site: K129 (= K98), Y217 (= Y185)
- binding alpha-D-glucopyranose: Y236 (≠ M204), I254 (≠ L222), Q256 (vs. gap)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: L39 (≠ T13), G40 (≠ A14), K41 (≠ E15), Y42 (≠ I16), S64 (= S37), G65 (≠ R38), K69 (≠ R42), Y87 (vs. gap), L106 (≠ V75), P107 (= P76), N108 (≠ T77), L110 (= L79), H111 (≠ R80), E128 (= E97), K129 (= K98), R157 (≠ M123), A196 (≠ N158), W199 (= W161), R200 (= R168), Y217 (= Y185)
Sites not aligning to the query:
1h6dA Oxidized precursor form of glucose-fructose oxidoreductase from zymomonas mobilis complexed with glycerol (see paper)
23% identity, 74% coverage: 2:260/348 of query aligns to 30:297/383 of 1h6dA
- active site: K131 (= K98), Y219 (= Y185)
- binding glycerol: K131 (= K98), R202 (= R168), D215 (= D181), Y219 (= Y185)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G40 (= G12), L41 (≠ T13), G42 (≠ A14), K43 (≠ E15), Y44 (≠ I16), S66 (= S37), G67 (≠ R38), K71 (≠ R42), Y89 (vs. gap), I107 (≠ P74), L108 (≠ V75), P109 (= P76), N110 (≠ T77), H113 (≠ R80), E130 (= E97), K131 (= K98), R159 (≠ M123), A198 (≠ N158), W201 (= W161), R202 (= R168), Y219 (= Y185)
Sites not aligning to the query:
4nheB The crystal structure of oxidoreductase (gfo/idh/moca family) from streptococcus pneumoniae tigr4 in complex with NADP
27% identity, 55% coverage: 6:195/348 of query aligns to 3:192/326 of 4nheB
- active site: K94 (= K98), Y182 (= Y185)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: T10 (= T13), I13 (= I16), S34 (= S37), R35 (= R38), T39 (≠ R42), A70 (≠ P74), S71 (≠ V75), P72 (= P76), N73 (≠ T77), H76 (≠ R80), E93 (= E97), K94 (= K98), R122 (≠ M123), N165 (= N166), F171 (≠ E174), Y182 (= Y185)
Query Sequence
>GFF1627 FitnessBrowser__Marino:GFF1627
MENRKVRWGIIGTAEIATKVVAGMHDAENADVVAVASRSLDRAQAWADEHDVPQALGSYD
ELLADESIDGVYIPVPTALRNEWIKKAARAGKHVYAEKPLADGIEEAIDVCKENGVQFMD
GTMWLHSNRTQDIEQRIANGDIGDVRRVTSAFTFKAPNKEWYEGGNGRTDKSREPMGCFG
DQGWYPISATMWSFGYELPERVQMTFVSKNSIDTIVACGGTLWFSDGRMATFDAGCELAH
RSQVETVGDAGLIRIDDLVGGQGRTGNFAAYGERFTGSSHYVLGDADGKDTEQEVEPCDH
VVKLVEKFSNIILTGEIDDQWPKRSLACHRVMSALFESAESNGAVISL
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory