Comparing GFF1644 FitnessBrowser__Phaeo:GFF1644 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 7 hits to proteins with known functional sites (download)
P32140 Sulfoquinovose isomerase; SQ isomerase; Sulfoquinovose-sulfofructose isomerase; SQ-SF isomerase; EC 5.3.1.31 from Escherichia coli (strain K12) (see paper)
34% identity, 95% coverage: 16:413/417 of query aligns to 3:412/413 of P32140
7ag4D Crystal structure of active site mutant of sq isomerase (yihs-h248a) from salmonella enterica in complex with sulfofructose (sf) (see paper)
34% identity, 93% coverage: 16:402/417 of query aligns to 15:407/425 of 7ag4D
2zblA Functional annotation of salmonella enterica yihs-encoded protein (see paper)
34% identity, 93% coverage: 16:402/417 of query aligns to 3:395/416 of 2zblA
8h1lB Crystal structure of glucose-2-epimerase in complex with d-glucitol from runella slithyformis runsl_4512 (see paper)
23% identity, 80% coverage: 42:373/417 of query aligns to 32:388/423 of 8h1lB
Sites not aligning to the query:
3wkiA Crystal structure of cellobiose 2-epimerase in complex with cellobiitol (see paper)
22% identity, 82% coverage: 54:394/417 of query aligns to 49:394/407 of 3wkiA
3wkhA Crystal structure of cellobiose 2-epimerase in complex with epilactose (see paper)
22% identity, 82% coverage: 54:394/417 of query aligns to 49:394/410 of 3wkhA
3wkgA Crystal structure of cellobiose 2-epimerase in complex with glucosylmannose (see paper)
22% identity, 82% coverage: 54:394/417 of query aligns to 49:394/410 of 3wkgA
>GFF1644 FitnessBrowser__Phaeo:GFF1644
MSTHSAVGDLSAPGVWLEDTGHQAYLIADARRQLDFFAGSLRAEPGFHTLDAAGRPLPDD
KQELHTTTRLVHSYALAHICGYAGAEQMIDHGMAYLNSHHRDQIHGGYLWALSGDAIADD
RKLAYGHVFVLLAAASAKLAGHPGADALLSDVAEVLDQRFWETGPKRFADEWNRDWTPFS
TYRGMNANMHGVEALLTAYEATGETVFLDRAGHILDFFVDEVAAAESWRLPEHYTETWQI
DRTYAGDPMFRPAGTTPGHSFELGRLMLQHWDLAGRRDTGAPTRARSLIEQALADAWLVD
GGFAYTLDFEGKVAMRNRFWWPVTEAIGAVATLVKLDGRVEDEQWYRRLWGFAQAHFIDE
DRGGWYPEIDGNGQVTRTIFTGKPDIYHALQACLLPLGALPLGHVAGLKKLSAPLLS
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory