Comparing GFF1649 FitnessBrowser__Phaeo:GFF1649 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3vk3A Crystal structure of l-methionine gamma-lyase from pseudomonas putida c116h mutant complexed with l-methionine (see paper)
37% identity, 96% coverage: 16:381/383 of query aligns to 21:396/397 of 3vk3A
5x30C Crystal structure of pseudomonas putida methionine gamma-lyase c116h mutant with l-homocysteine intermediates. (see paper)
37% identity, 96% coverage: 16:381/383 of query aligns to 17:392/393 of 5x30C
1pg8A Crystal structure of l-methionine alpha-, gamma-lyase
37% identity, 96% coverage: 16:381/383 of query aligns to 22:397/398 of 1pg8A
P13254 L-methionine gamma-lyase; MGL; Homocysteine desulfhydrase; L-methioninase; EC 4.4.1.11; EC 4.4.1.2 from Pseudomonas putida (Arthrobacter siderocapsulatus) (see 3 papers)
37% identity, 96% coverage: 16:381/383 of query aligns to 22:397/398 of P13254
5x2xA Crystal structure of pseudomonas putida methionine gamma-lyase wild type with l-homocysteine intermediates (see paper)
37% identity, 96% coverage: 16:381/383 of query aligns to 16:391/392 of 5x2xA
5x2wA Crystal structure of pseudomonas putida methionine gamma-lyase wild type with l-methionine intermediates (see paper)
37% identity, 96% coverage: 16:381/383 of query aligns to 16:391/392 of 5x2wA
7d7oB Crystal structure of cystathionine gamma-lyase from bacillus cereus atcc 14579 (see paper)
33% identity, 96% coverage: 14:379/383 of query aligns to 13:377/377 of 7d7oB
5m3zA Crystal structure of citrobacter freundii methionine gamma-lyase with c115h replacement in the complex with l-norleucine (see paper)
33% identity, 99% coverage: 2:382/383 of query aligns to 4:395/395 of 5m3zA
4omaA The crystal structure of methionine gamma-lyase from citrobacter freundii in complex with l-cycloserine pyridoxal-5'-phosphate (see paper)
33% identity, 99% coverage: 2:382/383 of query aligns to 5:396/396 of 4omaA
3jwbA Crystal structure of l-methionine gamma-lyase from citrobacter freundii with norleucine (see paper)
33% identity, 99% coverage: 2:382/383 of query aligns to 5:396/396 of 3jwbA
3jwaA Crystal structure of l-methionine gamma-lyase from citrobacter freundii with methionine phosphinate (see paper)
33% identity, 99% coverage: 2:382/383 of query aligns to 5:396/396 of 3jwaA
3jw9A Crystal structure of l-methionine gamma-lyase from citrobacter freundii with s-ethyl-cysteine (see paper)
33% identity, 99% coverage: 2:382/383 of query aligns to 5:396/396 of 3jw9A
1e5eA Methionine gamma-lyase (mgl) from trichomonas vaginalis in complex with propargylglycine
33% identity, 97% coverage: 8:378/383 of query aligns to 8:389/394 of 1e5eA
1e5fA Methionine gamma-lyase (mgl) from trichomonas vaginalis
33% identity, 97% coverage: 8:378/383 of query aligns to 8:389/393 of 1e5fA
4hf8A Crystal structure of l-methionine gamma-lyase from citrobacter freundii with glycine (see paper)
33% identity, 99% coverage: 2:382/383 of query aligns to 5:396/396 of 4hf8A
6egrA Crystal structure of citrobacter freundii methionine gamma-lyase with v358y replacement (see paper)
33% identity, 99% coverage: 2:382/383 of query aligns to 5:396/396 of 6egrA
7mcyH Crystal structure of staphylococcus aureus cystathionine gamma lyase, holoenzyme with bound nl3 (see paper)
33% identity, 95% coverage: 16:380/383 of query aligns to 15:379/380 of 7mcyH
Sites not aligning to the query:
7mcuH Crystal structure of staphylococcus aureus cystathionine gamma lyase, holoenzyme with bound nl2 (see paper)
33% identity, 95% coverage: 16:380/383 of query aligns to 15:379/380 of 7mcuH
Sites not aligning to the query:
7mctH Crystal structure of staphylococcus aureus cystathionine gamma lyase, holoenzyme with bound nl1 (see paper)
33% identity, 95% coverage: 16:380/383 of query aligns to 15:379/380 of 7mctH
Sites not aligning to the query:
7mcqA Crystal structure of staphylococcus aureus cystathionine gamma lyase, aoaa-bound enzyme in dimeric form (see paper)
33% identity, 95% coverage: 16:380/383 of query aligns to 15:379/380 of 7mcqA
>GFF1649 FitnessBrowser__Phaeo:GFF1649
MTEGLDLATLMAAVMEDGSGAITPPIVQTSLFSFDSYEAFEDRMAGRSNAAIYTRVQNPT
VAAFESLMAKAEQGEAAVAFASGMAAISSTLLAFVKPGDRIACVEHVYPDSYRFMERMLR
PFGVEIDYYAPHQLEEEPELLNGVRLAYLESPSSVVFQPLNLKKVTAHAKRHGVLTMIDN
SWASPVFQKPLTQGVDIVLHSASKYISGHSDTVAGVVVAAQQHIDRIRDLTLPLLGAKLA
PFEAFLLTRGLRTLSARMRQHQATATLFIDRLSALPQVRRVHSPGPNEVPGLTGRSGLMA
VEFDDSVDIPAFSNALSHFRLGVSWGGFESLILPARVGLAQIGEENSMQRFGVSPNLVRL
NLGLEEAEDLWADITSALATSTV
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory