SitesBLAST
Comparing GFF1728 FitnessBrowser__Marino:GFF1728 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3wx9A Crystal structure of pyrococcus horikoshii kynurenine aminotransferase in complex with pmp, gla, 4ad, 2og, glu and kya
33% identity, 67% coverage: 156:477/480 of query aligns to 70:398/404 of 3wx9A
- binding 2-oxoglutaric acid: D213 (= D295), P214 (≠ I296), Y215 (= Y297), G216 (≠ A298), E217 (= E299), G241 (≠ S322), T242 (≠ S323), I246 (≠ V327)
- binding (2E)-pent-2-enedioic acid: Y130 (≠ F216), N184 (≠ T266), R376 (= R455)
- binding glutamic acid: L131 (≠ Y217), V360 (≠ T439), A364 (≠ L443), R369 (≠ G448)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: G104 (= G190), S105 (≠ C191), Q106 (= Q192), Y130 (≠ F216), N184 (≠ T266), D212 (= D294), P214 (≠ I296), Y215 (= Y297), T242 (≠ S323), S244 (= S325), K245 (= K326), R252 (= R333)
Sites not aligning to the query:
3av7A Crystal structure of pyrococcus horikoshii kynurenine aminotransferase in complex with pmp, kyn as substrates and kya as products
33% identity, 67% coverage: 156:477/480 of query aligns to 70:398/404 of 3av7A
- binding 4-hydroxyquinoline-2-carboxylic acid: L131 (≠ Y217), Q135 (= Q221), A364 (≠ L443), R369 (≠ G448)
- binding (2S)-2-amino-4-(2-aminophenyl)-4-oxobutanoic acid: Y130 (≠ F216), L131 (≠ Y217), A132 (≠ G218), N184 (≠ T266), R376 (= R455)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: G104 (= G190), S105 (≠ C191), Q106 (= Q192), Y130 (≠ F216), V179 (vs. gap), N184 (≠ T266), D212 (= D294), P214 (≠ I296), Y215 (= Y297), T242 (≠ S323), S244 (= S325), K245 (= K326), R252 (= R333)
Sites not aligning to the query:
3aowC Crystal structure of pyrococcus horikoshii kynurenine aminotransferase in complex with akg
33% identity, 67% coverage: 156:477/480 of query aligns to 70:398/404 of 3aowC
- binding 2-oxoglutaric acid: Y70 (= Y156), Y130 (≠ F216), L275 (= L355)
- binding pyridoxal-5'-phosphate: G104 (= G190), S105 (≠ C191), Q106 (= Q192), Y130 (≠ F216), V179 (vs. gap), N184 (≠ T266), D212 (= D294), P214 (≠ I296), Y215 (= Y297), T242 (≠ S323), S244 (= S325), K245 (= K326), R252 (= R333)
Sites not aligning to the query:
3aovA Crystal structure of pyrococcus horikoshii kynurenine aminotransferase in complex with plp
33% identity, 67% coverage: 156:477/480 of query aligns to 70:398/404 of 3aovA
- binding pyridoxal-5'-phosphate: G104 (= G190), S105 (≠ C191), Q106 (= Q192), Y130 (≠ F216), V179 (vs. gap), N184 (≠ T266), D212 (= D294), P214 (≠ I296), Y215 (= Y297), T242 (≠ S323), S244 (= S325), K245 (= K326), R252 (= R333)
3cbfA Crystal structure of lysn, alpha-aminoadipate aminotransferase, from thermus thermophilus hb27 (see paper)
34% identity, 58% coverage: 180:459/480 of query aligns to 85:368/392 of 3cbfA
- binding (2S)-2-[({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)amino]hexanedioic acid: G95 (= G190), S96 (≠ C191), Q97 (= Q192), Y121 (≠ F216), N170 (≠ T266), D198 (= D294), Y201 (= Y297), S231 (= S323), S233 (= S325), K234 (= K326), R241 (= R333), R364 (= R455)
Sites not aligning to the query:
2egyA Crystal structure of lysn, alpha-aminoadipate aminotransferase (substrate free form), from thermus thermophilus hb27
34% identity, 58% coverage: 180:459/480 of query aligns to 85:368/392 of 2egyA
- binding pyridoxal-5'-phosphate: G95 (= G190), S96 (≠ C191), Q97 (= Q192), Y121 (≠ F216), N170 (≠ T266), D198 (= D294), A200 (≠ I296), Y201 (= Y297), S231 (= S323), S233 (= S325), K234 (= K326), R241 (= R333)
2zyjA Crystal structure of lysn, alpha-aminoadipate aminotransferase (complexed with n-(5'-phosphopyridoxyl)-l-glutamate), from thermus thermophilus hb27 (see paper)
34% identity, 58% coverage: 180:459/480 of query aligns to 89:372/397 of 2zyjA
- binding N-({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)-L-glutamic acid: G99 (= G190), S100 (≠ C191), Q101 (= Q192), Y125 (≠ F216), N174 (≠ T266), D202 (= D294), Y205 (= Y297), S235 (= S323), S237 (= S325), K238 (= K326), R245 (= R333), R368 (= R455)
Sites not aligning to the query:
Q72LL6 2-aminoadipate transaminase; 2-aminoadipate aminotransferase; Alpha-aminoadipate aminotransferase; AAA-AT; AadAT; EC 2.6.1.39 from Thermus thermophilus (strain ATCC BAA-163 / DSM 7039 / HB27) (see 2 papers)
34% identity, 58% coverage: 180:459/480 of query aligns to 89:372/397 of Q72LL6
- N174 (≠ T266) binding ; binding
- R245 (= R333) binding
- R368 (= R455) binding
Sites not aligning to the query:
- 20 S→E: Strongly decreases the affinity for AAA and Glu. A mild decrease of affinity is observed for 2-oxoglutarate. Increases the affinity for leucine and 2-oxoisocaproate.
- 23 R→A: Strongly decreases the affinity for AAA and Glu. A mild decrease of affinity is observed for 2-oxoglutarate which has the same chain length as Glu, but differs by the presence of a 2-oxo group which is not recognized by R-23. Increases the affinity for leucine and 2-oxoisocaproate due to the absence of gamma-carboxyl group.; R→Q: Strongly decreases the affinity for AAA and Glu. A mild decrease of affinity is observed for 2-oxoglutarate which has the same chain length as Glu, but differs by the presence of a 2-oxo group which is not recognized by R-23. Increases the affinity for leucine and 2-oxoisocaproate due to the absence of gamma-carboxyl group.
- 40 binding
- 70 binding
2z1yA Crystal structure of lysn, alpha-aminoadipate aminotransferase (complexed with n-(5'-phosphopyridoxyl)-l-leucine), from thermus thermophilus hb27
34% identity, 58% coverage: 180:459/480 of query aligns to 81:364/389 of 2z1yA
- binding leucine: Y117 (≠ F216), R360 (= R455)
- binding pyridoxal-5'-phosphate: G91 (= G190), S92 (≠ C191), Q93 (= Q192), Y117 (≠ F216), N166 (≠ T266), D194 (= D294), Y197 (= Y297), S227 (= S323), S229 (= S325), K230 (= K326), R237 (= R333)
Sites not aligning to the query:
2zc0A Crystal structure of an archaeal alanine:glyoxylate aminotransferase (see paper)
31% identity, 67% coverage: 156:476/480 of query aligns to 71:400/405 of 2zc0A
- active site: Y132 (≠ F216), D214 (= D294), A216 (≠ I296), S246 (= S325)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: G106 (= G190), G107 (≠ C191), T108 (≠ Q192), Y132 (≠ F216), N186 (≠ T266), D214 (= D294), A216 (≠ I296), Y217 (= Y297), T244 (≠ S323), S246 (= S325), K247 (= K326), R254 (= R333)
1wstA Crystal structure of multiple substrate aminotransferase (msat) from thermococcus profundus
29% identity, 67% coverage: 156:477/480 of query aligns to 67:396/403 of 1wstA
- binding pyridoxal-5'-phosphate: G102 (= G190), S103 (≠ C191), Q104 (= Q192), Y128 (≠ F216), V177 (vs. gap), N182 (≠ T266), D210 (= D294), P212 (≠ I296), Y213 (= Y297), T240 (≠ S323), S242 (= S325), K243 (= K326), R250 (= R333)
2xh1A Crystal structure of human kat ii-inhibitor complex (see paper)
31% identity, 61% coverage: 184:477/480 of query aligns to 97:408/412 of 2xh1A
- binding (3s)-10-(4-aminopiperazin-1-yl)-9-fluoro-7-hydroxy-3-methyl-2,3-dihydro-8h-[1,4]oxazino[2,3,4-ij]quinoline-6-carboxylate: L280 (= L355)
- binding pyridoxal-5'-phosphate: S104 (≠ C191), Q105 (= Q192), Y129 (≠ F216), D217 (= D294), P219 (≠ I296), S247 (= S323), S249 (= S325), R257 (= R333)
Sites not aligning to the query:
6t8qA Hkatii in complex with ligand (2r)-n-benzyl-1-[6-methyl-5-(oxan-4-yl)- 7-oxo-6h,7h-[1,3]thiazolo[5,4-d]pyrimidin-2-yl]pyrrolidine-2- carboxamide (see paper)
31% identity, 61% coverage: 184:477/480 of query aligns to 113:424/428 of 6t8qA
4gebA Kynurenine aminotransferase ii inhibitors (see paper)
31% identity, 61% coverage: 184:477/480 of query aligns to 110:421/428 of 4gebA
- binding (5-hydroxy-4-{[(7-hydroxy-6-oxo-2-phenyl-6,7-dihydro-2H-pyrazolo[3,4-b]pyridin-5-yl)amino]methyl}-6-methylpyridin-3-yl)methyl dihydrogen phosphate: S117 (≠ C191), Q118 (= Q192), Y142 (≠ F216), N202 (≠ T266), D230 (= D294), P232 (≠ I296), Y233 (= Y297), S260 (= S323), S262 (= S325), K263 (= K326), R270 (= R333), R399 (= R455)
Sites not aligning to the query:
4ge9A Kynurenine aminotransferase ii inhibitors (see paper)
31% identity, 61% coverage: 184:477/480 of query aligns to 110:421/428 of 4ge9A
- binding (4-{[(6-benzyl-1-hydroxy-7-methoxy-2-oxo-1,2-dihydroquinolin-3-yl)amino]methyl}-5-hydroxy-6-methylpyridin-3-yl)methyl dihydrogen phosphate: S117 (≠ C191), Q118 (= Q192), Y142 (≠ F216), N202 (≠ T266), D230 (= D294), P232 (≠ I296), Y233 (= Y297), S260 (= S323), S262 (= S325), R270 (= R333), L293 (= L355), R399 (= R455)
Sites not aligning to the query:
4ge7A Kynurenine aminotransferase ii inhibitors (see paper)
31% identity, 61% coverage: 184:477/480 of query aligns to 110:421/428 of 4ge7A
- binding (5-hydroxy-4-{[(1-hydroxy-2-oxo-6-phenoxy-1,2-dihydroquinolin-3-yl)amino]methyl}-6-methylpyridin-3-yl)methyl dihydrogen phosphate: S117 (≠ C191), Q118 (= Q192), Y142 (≠ F216), N202 (≠ T266), D230 (= D294), P232 (≠ I296), Y233 (= Y297), S260 (= S323), S262 (= S325), R270 (= R333), L293 (= L355), R399 (= R455)
Sites not aligning to the query:
4gdyB Kynurenine aminotransferase ii inhibitors
31% identity, 61% coverage: 184:477/480 of query aligns to 110:421/428 of 4gdyB
- binding (5-hydroxy-6-methyl-4-{[(1-oxo-7-phenoxy-1,2-dihydro[1,2,4]triazolo[4,3-a]quinolin-4-yl)amino]methyl}pyridin-3-yl)methyl dihydrogen phosphate: G116 (= G190), S117 (≠ C191), Q118 (= Q192), Y142 (≠ F216), N202 (≠ T266), D230 (= D294), P232 (≠ I296), S260 (= S323), S262 (= S325), R270 (= R333), R399 (= R455)
Sites not aligning to the query:
2vgzA Crystal structure of human kynurenine aminotransferase ii (see paper)
31% identity, 61% coverage: 184:477/480 of query aligns to 99:410/414 of 2vgzA
5tf5A Crystal structure of human kat-2 in complex with a reversible inhibitor
31% identity, 61% coverage: 184:477/480 of query aligns to 110:421/425 of 5tf5A
Sites not aligning to the query:
2r2nA The crystal structure of human kynurenine aminotransferase ii in complex with kynurenine (see paper)
31% identity, 61% coverage: 184:477/480 of query aligns to 110:421/425 of 2r2nA
- binding (2S)-2-amino-4-(2-aminophenyl)-4-oxobutanoic acid: Y142 (≠ F216), R399 (= R455)
- binding 4'-deoxy-4'-aminopyridoxal-5'-phosphate: S117 (≠ C191), Q118 (= Q192), Y142 (≠ F216), N202 (≠ T266), D230 (= D294), P232 (≠ I296), Y233 (= Y297), S260 (= S323), S262 (= S325), K263 (= K326), R270 (= R333)
Sites not aligning to the query:
Query Sequence
>GFF1728 FitnessBrowser__Marino:GFF1728
MVHTKFWGRLSLAEETHRYQQLEQWILQGIIDGRWKSGDRLPSIREICAQQGVSKATVQH
ALQRLEAQGFLEVRPKAGHFVTLAPKATAPPRTTSRIEAPRPVNVSDLLLDIMDRNAAFD
LLPKLHAGELPPGIVSLNRAIGRALRRQRGADFQYYDKPAGDLKLREQLGLLLAKRGWPV
TPDELCITSGCQHALFLALMACCQRGDVVAVESPGFYGVLQLLEQLGLQVMEIPTSTASG
MDMDALEEALGRWNIQACVVSPAFATPGGALMSEAPRRRLMALAEKYDLAVIEDDIYAES
GFSRVPDTLKALDENNRVIHCSSFSKVLSRDLRLGWISGARWHQRILHLKMVTQLASSRY
LQQGVAAYMEEGELSAHLRRQRKVLSEQRDRLLASLLAWPVSVRVTAPQGGLAVWLELPA
TVDTLAVYPKALDAGVVITPGPLFSASGKYGNCLRISFSHPWDERRIRALNQLPELLYLT
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory