Comparing GFF1848 FitnessBrowser__Marino:GFF1848 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6rz0A Crystal structure of escherichia coli glyoxalase ii
45% identity, 100% coverage: 2:264/264 of query aligns to 1:251/251 of 6rz0A
Q8ZRM2 Hydroxyacylglutathione hydrolase; Glyoxalase II; Glx II; EC 3.1.2.6 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
44% identity, 100% coverage: 2:264/264 of query aligns to 1:251/251 of Q8ZRM2
2qedA Crystal structure of salmonella thyphimurium lt2 glyoxalase ii (see paper)
44% identity, 100% coverage: 2:264/264 of query aligns to 2:252/252 of 2qedA
8ewoA Crystal structure of putative glyoxylase ii from pseudomonas aeruginosa
45% identity, 100% coverage: 1:264/264 of query aligns to 2:259/259 of 8ewoA
O24496 Hydroxyacylglutathione hydrolase cytoplasmic; Glyoxalase II; Glx II; EC 3.1.2.6 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
37% identity, 100% coverage: 2:264/264 of query aligns to 1:256/258 of O24496
Q9SID3 Hydroxyacylglutathione hydrolase 2, mitochondrial; Glyoxalase II; Glx II; EC 3.1.2.6 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
36% identity, 100% coverage: 2:264/264 of query aligns to 71:324/324 of Q9SID3
2q42A Ensemble refinement of the protein crystal structure of glyoxalase ii from arabidopsis thaliana gene at2g31350 (see paper)
36% identity, 100% coverage: 2:264/264 of query aligns to 1:254/254 of 2q42A
1qh5B Human glyoxalase ii with s-(n-hydroxy-n-bromophenylcarbamoyl) glutathione (see paper)
35% identity, 100% coverage: 2:264/264 of query aligns to 1:255/260 of 1qh5B
1qh5A Human glyoxalase ii with s-(n-hydroxy-n-bromophenylcarbamoyl) glutathione (see paper)
35% identity, 100% coverage: 2:264/264 of query aligns to 1:255/260 of 1qh5A
1qh3A Human glyoxalase ii with cacodylate and acetate ions present in the active site (see paper)
35% identity, 100% coverage: 2:264/264 of query aligns to 1:255/260 of 1qh3A
Q16775 Hydroxyacylglutathione hydrolase, mitochondrial; Glyoxalase II; Glx II; EC 3.1.2.6 from Homo sapiens (Human) (see paper)
35% identity, 100% coverage: 2:264/264 of query aligns to 49:303/308 of Q16775
2p18A Crystal structure of the leishmania infantum glyoxalase ii (see paper)
30% identity, 88% coverage: 2:233/264 of query aligns to 13:265/283 of 2p18A
4ysbA Crystal structure of ethe1 from myxococcus xanthus (see paper)
35% identity, 63% coverage: 11:175/264 of query aligns to 11:172/225 of 4ysbA
2gcuA X-ray structure of gene product from arabidopsis thaliana at1g53580 (see paper)
34% identity, 63% coverage: 11:175/264 of query aligns to 13:185/244 of 2gcuA
Q9C8L4 Persulfide dioxygenase ETHE1 homolog, mitochondrial; Glyoxalase II; Glx II; Sulfur dioxygenase ETHE1; EC 1.13.11.18 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
34% identity, 63% coverage: 11:175/264 of query aligns to 62:234/294 of Q9C8L4
3r2uB 2.1 angstrom resolution crystal structure of metallo-beta-lactamase from staphylococcus aureus subsp. Aureus col
32% identity, 56% coverage: 25:173/264 of query aligns to 29:189/336 of 3r2uB
Sites not aligning to the query:
3r2uA 2.1 angstrom resolution crystal structure of metallo-beta-lactamase from staphylococcus aureus subsp. Aureus col
31% identity, 56% coverage: 25:173/264 of query aligns to 27:197/348 of 3r2uA
2xf4A Crystal structure of salmonella enterica serovar typhimurium ycbl (see paper)
32% identity, 53% coverage: 4:144/264 of query aligns to 5:160/210 of 2xf4A
Sites not aligning to the query:
O95571 Persulfide dioxygenase ETHE1, mitochondrial; Ethylmalonic encephalopathy protein 1; Hepatoma subtracted clone one protein; Sulfur dioxygenase ETHE1; EC 1.13.11.18 from Homo sapiens (Human) (see 4 papers)
28% identity, 63% coverage: 11:175/264 of query aligns to 33:197/254 of O95571
Sites not aligning to the query:
5ve5A Crystal structure of persulfide dioxygenase rhodanese fusion protein with rhodanese domain inactivating mutation (c314s) from burkholderia phytofirmans in complex with glutathione (see paper)
30% identity, 63% coverage: 11:175/264 of query aligns to 14:178/350 of 5ve5A
Sites not aligning to the query:
>GFF1848 FitnessBrowser__Marino:GFF1848
MLTISAIPAFSDNYIWCLSDTASDKALIVDPGQAQPVLDHLAENGLTLDTILVTHHHPDH
VGGVKDLISRFPDCRVTGPADSPYKGSTNLVHPGDEVIWEDITFQVLGVPGHTLDHIAYF
TDVEVNGRPVLFCGDTLFVCGCGRLFEGSPEQMRQSLQTLRALPGKTAVYCAHEYTLANL
RFARSWLPEDEGLRTFEQECQAARDAGKPTVPSVLENEKRLNPFLRWDDPAVVDSARAYC
SSRGLPADSDNAIFAAIRHGKDNF
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory