SitesBLAST
Comparing GFF1886 FitnessBrowser__Phaeo:GFF1886 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q46337 Sarcosine oxidase subunit alpha; Sarcosine oxidase subunit A; Sarcosine oxidase (5,10-methylenetetrahydrofolate-forming) subunit alpha; Tetrameric sarcosine oxidase subunit alpha; TSOX subunit alpha; EC 1.5.3.24 from Corynebacterium sp. (strain P-1) (see 2 papers)
41% identity, 99% coverage: 12:1009/1010 of query aligns to 19:966/967 of Q46337
- G139 (= G179) mutation to A: Does not affect activity and binding of NAD(+).
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
Q50LF0 Sarcosine oxidase subunit alpha; Sarcosine oxidase subunit A; Sarcosine oxidase (5,10-methylenetetrahydrofolate-forming) subunit alpha; Tetrameric sarcosine oxidase subunit alpha; TSOX subunit alpha; EC 1.5.3.24 from Corynebacterium sp. (strain U-96) (see 2 papers)
41% identity, 99% coverage: 9:1009/1010 of query aligns to 14:964/965 of Q50LF0
- A139 (= A181) binding
- D158 (≠ E200) binding
- E159 (≠ Q201) binding
- R160 (≠ N202) binding
- T166 (≠ R208) binding
- V205 (≠ G246) binding
- A418 (= A462) binding
- L423 (≠ A467) binding
- T425 (≠ L469) binding
3ad7A Heterotetrameric sarcosine oxidase from corynebacterium sp. U-96 in complex with methylthio acetate (see paper)
41% identity, 99% coverage: 9:1009/1010 of query aligns to 13:963/963 of 3ad7A
- active site: L349 (≠ K386), L374 (≠ V411), D676 (= D719)
- binding flavin mononucleotide: K509 (= K553), R510 (= R554), T516 (≠ M560), Q520 (= Q564), T548 (= T591), R550 (= R593)
- binding nicotinamide-adenine-dinucleotide: G134 (= G177), G136 (= G179), P137 (≠ V180), A138 (= A181), D157 (≠ E200), E158 (≠ Q201), R159 (≠ N202), T165 (≠ R208), V204 (≠ G246), T248 (= T287), A249 (≠ G288), S294 (≠ D333), F380 (≠ W417), G416 (= G461), L422 (≠ A467), D423 (≠ G468), T424 (≠ L469)
1vrqA Crystal structure of heterotetrameric sarcosine oxidase from corynebacterium sp. U-96 in complex with folinic acid (see paper)
41% identity, 99% coverage: 9:1009/1010 of query aligns to 13:963/963 of 1vrqA
- active site: L349 (≠ K386), L374 (≠ V411), D676 (= D719)
- binding flavin mononucleotide: K509 (= K553), R510 (= R554), T516 (≠ M560), Q520 (= Q564), T548 (= T591), R550 (= R593)
- binding N-{[4-({[(6R)-2-amino-5-formyl-4-oxo-1,4,5,6,7,8-hexahydropteridin-6-yl]methyl}amino)phenyl]carbonyl}-L-glutamic acid: L631 (= L674), Y663 (= Y706), G677 (= G720), H690 (= H733), I774 (= I820), F776 (= F822), E783 (= E829), K822 (= K868), F824 (= F870)
- binding nicotinamide-adenine-dinucleotide: G134 (= G177), G136 (= G179), P137 (≠ V180), A138 (= A181), D157 (≠ E200), E158 (≠ Q201), R159 (≠ N202), T165 (≠ R208), V204 (≠ G246), T248 (= T287), A249 (≠ G288), S294 (≠ D333), F380 (≠ W417), G416 (= G461), L422 (≠ A467), D423 (≠ G468), T424 (≠ L469)
2gagA Heteroteterameric sarcosine: structure of a diflavin metaloenzyme at 1.85 a resolution (see paper)
41% identity, 99% coverage: 12:1009/1010 of query aligns to 17:964/965 of 2gagA
- active site: L350 (≠ K386), L375 (≠ V411), D677 (= D719)
- binding flavin mononucleotide: K510 (= K553), R511 (= R554), T517 (≠ M560), Q521 (= Q564), T549 (= T591), R551 (= R593)
- binding 2-furoic acid: N647 (≠ D689), G653 (≠ M695), T655 (≠ S697), K851 (= K896)
- binding nicotinamide-adenine-dinucleotide: V134 (≠ I176), G135 (= G177), G137 (= G179), P138 (≠ V180), A139 (= A181), D158 (≠ E200), E159 (≠ Q201), R160 (≠ N202), G165 (= G207), T166 (≠ R208), T204 (≠ M245), V205 (≠ G246), T249 (= T287), G250 (= G288), S295 (≠ D333), F381 (≠ W417), G417 (= G461), A418 (= A462), L423 (≠ A467), D424 (≠ G468), T425 (≠ L469), Y554 (= Y596)
1worA Crystal structure of t-protein of the glycine cleavage system (see paper)
29% identity, 38% coverage: 616:1001/1010 of query aligns to 1:356/362 of 1worA
1wopA Crystal structure of t-protein of the glycine cleavage system (see paper)
29% identity, 38% coverage: 616:1001/1010 of query aligns to 1:356/362 of 1wopA
- active site: D96 (= D719)
- binding N-[4-({[(6S)-2-amino-5-formyl-4-oxo-3,4,5,6,7,8-hexahydropteridin-6-yl]methyl}amino)benzoyl]-L-glutamic acid: M51 (≠ L674), L55 (≠ V678), Y83 (= Y706), D96 (= D719), V98 (= V721), E106 (≠ T729), L108 (= L731), V110 (≠ H733), N112 (≠ T735), I137 (= I764), E160 (= E787), Y168 (≠ F802), Y169 (≠ M803), K173 (≠ D807), S174 (≠ G808), I175 (≠ E809), E180 (≠ K814), T181 (≠ A815), Y188 (≠ F822), E195 (= E829), M197 (≠ A831), R227 (≠ L861), Y236 (≠ F870)
Sites not aligning to the query:
1wooA Crystal structure of t-protein of the glycine cleavage system (see paper)
29% identity, 38% coverage: 616:1001/1010 of query aligns to 1:356/362 of 1wooA
- active site: D96 (= D719)
- binding (6s)-5,6,7,8-tetrahydrofolate: M51 (≠ L674), Y83 (= Y706), D96 (= D719), V98 (= V721), V110 (≠ H733), N112 (≠ T735), Y168 (≠ F802), Y169 (≠ M803), Y188 (≠ F822), E195 (= E829), Y236 (≠ F870)
Sites not aligning to the query:
Q9UI17 Dimethylglycine dehydrogenase, mitochondrial; ME2GLYDH; EC 1.5.8.4 from Homo sapiens (Human) (see 4 papers)
27% identity, 36% coverage: 638:998/1010 of query aligns to 490:845/866 of Q9UI17
- A530 (≠ G667) to G: in dbSNP:rs1805073
- S646 (≠ E787) to P: in dbSNP:rs1805074
Sites not aligning to the query:
- 59:60 binding
- 80:81 binding
- 87:95 binding
- 91 modified: Tele-8alpha-FAD histidine
- 109 H → R: in DMGDHD; shows 10 fold lower catalytic efficiency due to lower cofactor saturation and reduced thermal stability; dbSNP:rs121908331
- 219 binding
- 279 S → P: in dbSNP:rs532964
- 397:402 binding
Q8GAI3 4-methylaminobutanoate oxidase (formaldehyde-forming); MABO; Demethylating gamma-N-methylaminobutyrate oxidase; Gamma-N-methylaminobutyrate oxidase 1; EC 1.5.3.19 from Paenarthrobacter nicotinovorans (Arthrobacter nicotinovorans) (see paper)
29% identity, 39% coverage: 616:1007/1010 of query aligns to 437:821/824 of Q8GAI3
Sites not aligning to the query:
- 66 mutation W->F,S: Contains a non-covalently bound FAD. Loss of enzyme activity.
- 67 H→A: Contains a non-covalently bound FAD. Exhibits about 10% of the wild-type enzyme activity.
Q63342 Dimethylglycine dehydrogenase, mitochondrial; ME2GLYDH; EC 1.5.8.4 from Rattus norvegicus (Rat) (see 2 papers)
27% identity, 36% coverage: 638:998/1010 of query aligns to 483:838/857 of Q63342
Sites not aligning to the query:
- 52:53 binding
- 73:74 binding
- 80:88 binding
- 84 modified: Tele-8alpha-FAD histidine
- 212 binding
- 244 binding
- 390:395 binding
4pabB Crystal structure of the precursor form of rat dmgdh complexed with tetrahydrofolate (see paper)
27% identity, 36% coverage: 638:998/1010 of query aligns to 446:801/824 of 4pabB
- active site: E536 (≠ D728)
- binding (6s)-5,6,7,8-tetrahydrofolate: I523 (≠ Y706), E536 (≠ D728), T538 (≠ W730), I550 (= I742), F612 (= F802), L613 (≠ M803), Y632 (≠ F822), E639 (= E829), F680 (= F870), Y700 (≠ W890)
Sites not aligning to the query:
- active site: 53, 102, 226, 255
- binding flavin-adenine dinucleotide: 11, 12, 14, 15, 16, 35, 36, 37, 43, 44, 45, 47, 48, 49, 50, 51, 175, 204, 205, 207, 226, 228, 326, 328, 353, 355, 356, 357, 358
1pj6A Crystal structure of dimethylglycine oxidase of arthrobacter globiformis in complex with folic acid (see paper)
28% identity, 35% coverage: 616:966/1010 of query aligns to 428:786/828 of 1pj6A
Sites not aligning to the query:
- active site: 223, 257
- binding flavin-adenine dinucleotide: 9, 11, 12, 13, 33, 34, 42, 43, 44, 46, 48, 50, 172, 201, 202, 204, 223, 257, 331, 332, 358, 359, 360, 361
Q9AGP8 Dimethylglycine oxidase; DMGO; EC 1.5.3.10 from Arthrobacter globiformis (see 2 papers)
28% identity, 35% coverage: 616:966/1010 of query aligns to 430:788/830 of Q9AGP8
- Y539 (= Y706) binding
- D552 (= D719) Important for catalytic activity; mutation to A: No effect on the activity.; mutation to N: Reduces activity 3-fold.
Sites not aligning to the query:
- 14:15 binding
- 35:36 binding
- 45:48 binding
- 52 binding
- 174 binding
- 225 Important for catalytic activity; H→Q: Reduces catalytic efficiency 3-fold and substrate affinity 30-fold.
- 259 Important for catalytic activity; binding ; Y→F: Reduces catalytic efficiency 225-fold and substrate affinity 25-fold.
- 360:363 binding
1pj7A Structure of dimethylglycine oxidase of arthrobacter globiformis in complex with folinic acid (see paper)
28% identity, 35% coverage: 616:966/1010 of query aligns to 427:785/827 of 1pj7A
- active site: D549 (= D719)
- binding N-[4-({[(6S)-2-amino-5-formyl-4-oxo-3,4,5,6,7,8-hexahydropteridin-6-yl]methyl}amino)benzoyl]-L-glutamic acid: L505 (= L674), Y536 (= Y706), D549 (= D719), T551 (≠ V721), G563 (vs. gap), F629 (≠ M803), Y648 (≠ F822), E655 (= E829), Y696 (≠ F870)
Sites not aligning to the query:
- active site: 222, 256
- binding flavin-adenine dinucleotide: 8, 10, 11, 12, 32, 33, 41, 42, 43, 45, 47, 49, 170, 171, 200, 201, 203, 222, 256, 331, 357, 358, 359, 360
3gsiA Crystal structure of d552a dimethylglycine oxidase mutant of arthrobacter globiformis in complex with tetrahydrofolate (see paper)
27% identity, 35% coverage: 616:966/1010 of query aligns to 427:785/827 of 3gsiA
- active site: A549 (≠ D719)
- binding (6s)-5,6,7,8-tetrahydrofolate: L505 (= L674), Y536 (= Y706), T551 (≠ V721), G563 (vs. gap), F629 (≠ M803), Y648 (≠ F822), E655 (= E829), Y696 (≠ F870)
Sites not aligning to the query:
- active site: 222, 256
- binding flavin-adenine dinucleotide: 10, 11, 12, 32, 33, 41, 42, 43, 45, 47, 49, 170, 171, 200, 201, 203, 222, 256, 330, 331, 332, 357, 358, 359, 360
- binding magnesium ion: 254, 409
3a8iA Crystal structure of et-ehred-5-ch3-thf complex (see paper)
27% identity, 35% coverage: 617:973/1010 of query aligns to 2:332/363 of 3a8iA
- active site: D97 (= D719)
- binding 5-methyl-5,6,7,8-tetrahydrofolic acid: M51 (≠ L674), Y84 (= Y706), D97 (= D719), I99 (≠ V721), V111 (≠ H733), N113 (≠ T735), F173 (= F802), Y188 (≠ F822), E195 (= E829), R223 (≠ L861), M232 (≠ F870), W252 (= W890)
P48728 Aminomethyltransferase, mitochondrial; Glycine cleavage system T protein; GCVT; EC 2.1.2.10 from Homo sapiens (Human) (see 4 papers)
27% identity, 36% coverage: 616:981/1010 of query aligns to 33:376/403 of P48728
- D129 (= D719) mutation D->A,N: Loss of aminomethyltransferase activity.
- N145 (≠ T735) to I: in GCE2; loss of aminomethyltransferase activity; dbSNP:rs386833682
- E232 (= E829) binding
- R261 (≠ L861) binding
- G269 (= G869) to D: in GCE2; decreased aminomethyltransferase activity; dbSNP:rs121964981
- R320 (≠ Q917) to H: in GCE2; loss of aminomethyltransferase activity; dbSNP:rs121964985
Sites not aligning to the query:
1wsvA Crystal structure of human t-protein of glycine cleavage system (see paper)
27% identity, 36% coverage: 616:981/1010 of query aligns to 2:345/371 of 1wsvA
- active site: D98 (= D719)
- binding n-[4-({[(6s)-2-amino-4-hydroxy-5-methyl-5,6,7,8-tetrahydropteridin-6-yl]methyl}amino)benzoyl]-l-glutamic acid: M53 (≠ L674), L85 (≠ Y706), D98 (= D719), L99 (≠ G720), I100 (≠ V721), V112 (≠ H733), N114 (≠ T735), F173 (= F802), G193 (≠ S821), Y194 (≠ F822), E201 (= E829), R230 (≠ L861), L239 (≠ F870)
Sites not aligning to the query:
A0A1J1EM40 Sesamin methylene transferase; Sesamin-metabolizing enzyme; THF-dependent sesamin/sesamin-monocatechol methylenetransferase; EC 2.1.5.1 from Sinomonas sp. (strain No.22) (see paper)
32% identity, 19% coverage: 679:870/1010 of query aligns to 55:230/452 of A0A1J1EM40
- D95 (= D719) mutation to A: 60% decrease in activity.
- E189 (= E829) mutation to A: Loss of activity.
- Y221 (≠ L861) mutation to A: Loss of activity.
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
Query Sequence
>GFF1886 FitnessBrowser__Phaeo:GFF1886
MSTRLAKNGRLIDRSKPIEFTFNGKRMKGYAGDTLASALLANDQMMVGRSFKYHRPRGLV
AAGPEEPNALVGLGTGDRFEPNQRATTTELFSGLSAQSQNHWPSLEFDVGVANNALARFL
PAGFYYKMFIHPRPLWKHVYEPIIRHSAGLGKAPDKELKDADTYEHFYYFADVLVIGGGV
AGLQAAKAAAMSGAKVLLLEQNNHWGGRAPVDGGTIDGMEPDAWVEKTLAELRGMDNVLL
RDRCMGAGVYDHGYALGYERLTDHAPGQGGPRHRLWRIRASQIVTATGAIERPLSFAGND
VPGVMLAASMRDYAVNWGVTPGQKVVVATNNDDAYRTAIALHAAGVEVVRVLDARDSGGG
ALMEEVRQLGIRVECGRAIAKVKGGKRVTSVAICAQNGEGGAQEEVEADAVAMSGGWSPV
VHLWSHCGGKLIWDQAHANFRPDASRPPLGADGKGFVIAAGAANGAAGLAEALSDAQAAG
EAAAKAAGRKVKAGTAPVGDAPTETAMEPVWLMPAKADIKLRMKTWLDYQNDVKVSDVQL
AAREGYESVEHTKRYTTLGMATDQGKLSNINGLAILADALGSEIPQVGTTTFRPPYHPIS
MGAIGGEARGEIFQPLRKTPMHDWHDSNGADWEPVGQWRRPFAYVRSGESLHDAVNREVK
NTRENLGLLDASTLGKLVVKGPDAGKFLDMMYTNMMSTLKIGKCRYGLMCSENGFLIDDG
VVARIDEDTWLCHTTTGGAERIHGHMEEWLQTEWWDWKVYVANITEQLAQVAVVGPNARK
VLEKLNENAGGGMDLSKEALPFMEWRDGEIGGFKARAYRISFSGELSYEIAVAASDGQAF
WTALMEAGKEFGVMPYGTECLHILRAEKGFIMIGDETDGTVIPQDLGLNWALSKKKEDFL
GKRAHTRSHMADPDRWQLVGLETTDGSVLPDGAYAVGNGVNANGQKNTIGRVTSTYYSSN
LGRGIAMGLVKHGPKRMGEVIEFPGTDGTIYKAKIVDQVFYDKEGEKQNV
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory