Comparing GFF1918 FitnessBrowser__Phaeo:GFF1918 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 14 hits to proteins with known functional sites (download)
8hqqA Crystal structure of the glucose-binding protein sar11_0769 from "candidatus pelagibacter ubique" htcc1062 bound to glucose
38% identity, 91% coverage: 26:400/414 of query aligns to 4:385/398 of 8hqqA
5dvjA Crystal structure of galactose complexed periplasmic glucose binding protein (ppgbp) from p. Putida csv86 (see paper)
38% identity, 93% coverage: 28:413/414 of query aligns to 6:395/396 of 5dvjA
5dviA High resolution crystal structure of glucose complexed periplasmic glucose binding protein (ppgbp) from p. Putida csv86 (see paper)
38% identity, 93% coverage: 28:413/414 of query aligns to 6:395/396 of 5dviA
4r2bA Crystal structure of sugar transporter oant_3817 from ochrobactrum anthropi, target efi-510528, with bound glucose
36% identity, 94% coverage: 23:411/414 of query aligns to 3:392/395 of 4r2bA
2b3fA Thermus thermophilus glucose/galactose binding protein bound with galactose (see paper)
30% identity, 81% coverage: 25:359/414 of query aligns to 1:334/392 of 2b3fA
Sites not aligning to the query:
2b3bC Thermus thermophilus glucose/galactose binding protein with bound glucose (see paper)
30% identity, 81% coverage: 25:359/414 of query aligns to 1:334/392 of 2b3bC
Sites not aligning to the query:
2b3bA Thermus thermophilus glucose/galactose binding protein with bound glucose (see paper)
30% identity, 81% coverage: 25:359/414 of query aligns to 1:334/392 of 2b3bA
Sites not aligning to the query:
3oo6A Crystal structures and biochemical characterization of the bacterial solute receptor acbh reveal an unprecedented exclusive substrate preference for b-d-galactopyranose (see paper)
29% identity, 43% coverage: 127:306/414 of query aligns to 104:281/390 of 3oo6A
Sites not aligning to the query:
4g68A Biochemical and structural insights into xylan utilization by the thermophilic bacteriumcaldanaerobius polysaccharolyticus (see paper)
23% identity, 83% coverage: 67:408/414 of query aligns to 45:389/392 of 4g68A
Sites not aligning to the query:
7ehqA Chitin oligosaccharide binding protein (see paper)
31% identity, 36% coverage: 127:274/414 of query aligns to 110:257/406 of 7ehqA
Sites not aligning to the query:
7ehpA Chitin oligosaccharide binding protein (see paper)
23% identity, 67% coverage: 74:349/414 of query aligns to 55:331/397 of 7ehpA
Sites not aligning to the query:
3vxcA Crystal structure of xylobiose-bxle complex from streptomyces thermoviolaceus opc-520
27% identity, 34% coverage: 127:268/414 of query aligns to 107:249/398 of 3vxcA
Sites not aligning to the query:
4r2fA Crystal structure of sugar transporter achl_0255 from arthrobacter chlorophenolicus a6, target efi-510633, with bound laminaribiose
34% identity, 18% coverage: 110:185/414 of query aligns to 90:163/394 of 4r2fA
Sites not aligning to the query:
4c1tA Structure of the xylo-oligosaccharide specific solute binding protein from bifidobacterium animalis subsp. Lactis bl-04 in complex with arabinoxylotriose (see paper)
23% identity, 52% coverage: 127:343/414 of query aligns to 106:331/396 of 4c1tA
Sites not aligning to the query:
>GFF1918 FitnessBrowser__Phaeo:GFF1918
MNFKSNLLAGVATLAMTSAATADGIRAEVIHWWVSAGEAAAIKVFADAYTANGGEWIDNG
IGGGGAKTTFVNRLMGGDAPQVGQFNTSREFEEIVDAGLLHSLDAEAEAGNWSALFPGII
DNVVKRDGSYYAVPVNIHGSNWLWHNNQVMADAGLDVPTDWDSFFEAAETLKEAGIIPLA
VGGEAWQERLTFNSVLLSVGGQDLYLRLFEEKDTTALTSDEMKEVFDVYSRLRTLVRETD
PGSPGRSWNDATNMVITGQAAMQIMGDWAKGEFLSAGMTPGVEYGCTPAVIAGSPYMISG
DVFVFPKTGNEEDREAQSLMATTMLDAEVQVAFNNIKGSIPVRPDVDTSQLDVCGQQAIA
LTSNPDTHVGVTQMYISSDLAGALQDVYTQFWNSETMTTEEAITLLSQAYEIAG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory