Comparing GFF1984 FitnessBrowser__Phaeo:GFF1984 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5cm6A Crystal structure of a trap periplasmic solute binding protein from pseudoalteromonas atlantica t6c(patl_2292, target efi-510180) with bound sodium and pyruvate
39% identity, 88% coverage: 36:351/360 of query aligns to 7:324/331 of 5cm6A
4petA Crystal structure of a trap periplasmic solute binding protein from colwellia psychrerythraea (cps_0129, target efi-510097) with bound calcium and pyruvate (see paper)
37% identity, 88% coverage: 36:351/360 of query aligns to 8:325/329 of 4petA
7ug8B Crystal structure of a solute receptor from synechococcus cc9311 in complex with alpha-ketovaleric and calcium
39% identity, 79% coverage: 36:320/360 of query aligns to 9:293/330 of 7ug8B
Q3J1R2 Alpha-keto acid-binding periplasmic protein TakP; Extracytoplasmic solute receptor protein TakP; TRAP transporter alpha-keto acid-binding subunit P; TRAP-T family sorbitol/mannitol transporter, periplasmic binding protein, SmoM from Cereibacter sphaeroides (strain ATCC 17023 / DSM 158 / JCM 6121 / CCUG 31486 / LMG 2827 / NBRC 12203 / NCIMB 8253 / ATH 2.4.1.) (Rhodobacter sphaeroides) (see paper)
34% identity, 98% coverage: 1:351/360 of query aligns to 1:352/365 of Q3J1R2
2hzlB Crystal structures of a sodium-alpha-keto acid binding subunit from a trap transporter in its closed forms (see paper)
32% identity, 89% coverage: 31:351/360 of query aligns to 3:324/337 of 2hzlB
4yicA Crystal structure of a trap transporter solute binding protein (ipr025997) from bordetella bronchiseptica rb50 (bb0280, target efi- 500035) with bound picolinic acid
33% identity, 88% coverage: 36:350/360 of query aligns to 9:324/344 of 4yicA
Q5SK82 Lactate-binding periplasmic protein TTHA0766; ABC transporter, solute-binding protein; Extracytoplasmic solute receptor protein TTHA0766; TRAP transporter lactate-binding subunit P from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see paper)
28% identity, 84% coverage: 1:301/360 of query aligns to 4:308/361 of Q5SK82
Sites not aligning to the query:
2zzwA Crystal structure of a periplasmic substrate binding protein in complex with zinc and lactate (see paper)
27% identity, 73% coverage: 38:301/360 of query aligns to 9:277/330 of 2zzwA
2zzvA Crystal structure of a periplasmic substrate binding protein in complex with calcium and lactate (see paper)
27% identity, 73% coverage: 38:301/360 of query aligns to 9:277/330 of 2zzvA
4pe3A Crystal structure of a trap periplasmic solute binding protein from rhodobacter sphaeroides (rsph17029_3620, target efi-510199), apo open structure (see paper)
28% identity, 68% coverage: 55:299/360 of query aligns to 23:267/315 of 4pe3A
Sites not aligning to the query:
7e9yA Crystal structure of elacco1 (see paper)
29% identity, 52% coverage: 38:223/360 of query aligns to 9:194/563 of 7e9yA
Sites not aligning to the query:
2pfzA Crystal structure of dctp6, a bordetella pertussis extracytoplasmic solute receptor binding pyroglutamic acid (see paper)
28% identity, 66% coverage: 47:283/360 of query aligns to 16:248/301 of 2pfzA
4p8bA Crystal structure of a trap periplasmic solute binding protein from ralstonia eutropha h16 (h16_a1328), target efi-510189, with bound (s)-2-hydroxy-2-methyl-3-oxobutanoate ((s)-2-acetolactate) (see paper)
23% identity, 82% coverage: 40:333/360 of query aligns to 17:311/314 of 4p8bA
4x8rA Crystal structure of a trap periplasmic solute binding protein from rhodobacter sphaeroides (rsph17029_2138, target efi-510205) with bound glucuronate
25% identity, 69% coverage: 51:299/360 of query aligns to 22:268/304 of 4x8rA
Sites not aligning to the query:
4xf5A Crystal structure of a trap periplasmic solute binding protein from chromohalobacter salexigens dsm 3043 (csal_0678), target efi-501078, with bound (s)-(+)-2-amino-1-propanol.
22% identity, 86% coverage: 43:352/360 of query aligns to 12:315/317 of 4xf5A
Sites not aligning to the query:
4uabA Crystal structure of a trap periplasmic solute binding protein from chromohalobacter salexigens dsm 3043 (csal_0678), target efi-501078, with bound ethanolamine (see paper)
22% identity, 86% coverage: 43:352/360 of query aligns to 11:314/315 of 4uabA
Sites not aligning to the query:
7nswBBB TRAP dicarboxylate transporter-DctP subunit (see paper)
26% identity, 74% coverage: 56:323/360 of query aligns to 29:299/328 of 7nswBBB
7ntdAAA TRAP dicarboxylate transporter-DctP subunit (see paper)
26% identity, 74% coverage: 56:323/360 of query aligns to 27:297/322 of 7ntdAAA
Sites not aligning to the query:
4mncA Crystal structure of a trap periplasmic solute binding protein from polaromonas sp. Js666 (bpro_4736), target efi-510156, with bound benzoyl formate, space group p21 (see paper)
24% identity, 79% coverage: 33:316/360 of query aligns to 4:276/305 of 4mncA
4pf8A Crystal structure of a trap periplasmic solute binding protein from sulfitobacter sp. Nas-14.1 (target efi-510299) with bound beta-d- galacturonate (see paper)
25% identity, 45% coverage: 157:318/360 of query aligns to 121:292/300 of 4pf8A
Sites not aligning to the query:
>GFF1984 FitnessBrowser__Phaeo:GFF1984
MDRRSFLKTSALGGSAAAATTLAAPAYAQGKRTLTMVTTWGRGLAGVHDSAQYVADAITA
MSGGDLTVDVKAAGELVGAFEVFDAVTAGQADMYHGADYYFTGQHPGYAYFTAVPFGMTP
QELTNWYYHGDGHALHDELGQIFGLKSFIGGNTGPQAGGWYNKEIKGPEDFNGLKFRMPG
LGGKALGKLGASVQNIPGSEVYQALSSGAIDGTEWIGPWADEKAGFQEITKTYYTAGFHE
PGAALSVATNRDVFEGLSPAHQKVIEMASAAGHQWSLAQFMNNNGAALQRLQSGGVKTLE
FPDSVWDAFGSATKETLDEFMGDELFAKIRGSVEESMKASSGWITKSEGAYRVQRDRVLG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory