SitesBLAST
Comparing GFF2076 FitnessBrowser__psRCH2:GFF2076 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 9 hits to proteins with known functional sites (download)
S5FMM4 Glycine oxidase; GO; BliGO; EC 1.4.3.19 from Bacillus licheniformis (see paper)
32% identity, 38% coverage: 246:402/414 of query aligns to 196:350/369 of S5FMM4
- S202 (≠ A252) mutation to C: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-54, R-81, V-332 and V-342.
- I332 (≠ F384) mutation to V: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-54, R-81, C-202 and V-342.
- M342 (≠ L394) mutation to V: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-54, R-81, C-202 and V-332.
Sites not aligning to the query:
- 51 G→S: Shows 4.3- and 107-fold increase of affinity to glyphosate and glycine, respectively. Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with R-54, R-81, C-202, V-332 and V-342.
- 54 A→R: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-81, C-202, V-332 and V-342.
- 81 K→R: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-54, C-202, V-332 and V-342.
O31616 Glycine oxidase; GO; EC 1.4.3.19 from Bacillus subtilis (strain 168) (see 3 papers)
25% identity, 71% coverage: 103:398/414 of query aligns to 89:346/369 of O31616
- V174 (≠ A211) binding
- H244 (≠ N297) mutation to A: 2-fold decrease in catalytic efficiency on glycine and similar catalytic efficiency on glyphosate. 60-fold decrease in catalytic efficiency on glycine and 210-fold increase in that on glyphosate; when associated with S-51 and R-54.
- R302 (= R355) binding
- 327:333 (vs. 379:385, 29% identical) binding
- R329 (≠ S381) binding
Sites not aligning to the query:
- 14:15 binding
- 34:35 binding
- 42:43 binding
- 47:49 binding
- 51 G→R: 130-fold decrease in catalytic efficiency on glycine and 28-fold increase in that on glyphosate.; G→S: 60-fold decrease in catalytic efficiency on glycine and 210-fold increase in that on glyphosate; when associated with R-54 and A-244.
- 54 A→R: 20-fold decrease in catalytic efficiency on glycine and 34-fold increase in that on glyphosate. 60-fold decrease in catalytic efficiency on glycine and 210-fold increase in that on glyphosate; when associated with S-51 and A-244.
1ng3A Complex of thio (glycine oxidase) with acetyl-glycine (see paper)
25% identity, 71% coverage: 103:398/414 of query aligns to 89:346/364 of 1ng3A
- binding acetylamino-acetic acid: Y246 (≠ V299), R302 (= R355), R329 (≠ S381)
- binding flavin-adenine dinucleotide: V174 (≠ A211), S202 (≠ A252), G203 (= G253), W205 (≠ G255), F209 (≠ L259), G300 (= G353), R302 (= R355), H327 (= H379), R329 (≠ S381), N330 (≠ L382), G331 (= G383), I332 (≠ F384)
- binding phosphate ion: R89 (= R103), R254 (≠ Q307)
Sites not aligning to the query:
- active site: 47, 48, 49
- binding flavin-adenine dinucleotide: 11, 13, 15, 33, 34, 35, 41, 42, 43, 46, 47, 48, 49
3if9A Crystal structure of glycine oxidase g51s/a54r/h244a mutant in complex with inhibitor glycolate (see paper)
25% identity, 71% coverage: 103:398/414 of query aligns to 89:346/364 of 3if9A
- binding flavin-adenine dinucleotide: P173 (≠ G210), V174 (≠ A211), S202 (≠ A252), G203 (= G253), W205 (≠ G255), F209 (≠ L259), G300 (= G353), R302 (= R355), H327 (= H379), F328 (≠ G380), R329 (≠ S381), N330 (≠ L382), G331 (= G383), I332 (≠ F384)
- binding glycolic acid: Y246 (≠ V299), R302 (= R355), R329 (≠ S381)
Sites not aligning to the query:
- active site: 47, 48, 49
- binding flavin-adenine dinucleotide: 11, 13, 15, 34, 35, 42, 43, 46, 47, 48, 49
6j39A Crystal structure of cmis2 with inhibitor (see paper)
29% identity, 72% coverage: 109:406/414 of query aligns to 58:360/368 of 6j39A
- binding (3R)-3-[(carboxymethyl)sulfanyl]nonanoic acid: R243 (≠ N291), Y252 (≠ V299), Y267 (≠ V314), R308 (= R355), R334 (≠ S381), I335 (≠ L382)
- binding flavin-adenine dinucleotide: A174 (≠ T219), A203 (= A252), W206 (≠ G255), I228 (≠ S276), Y252 (≠ V299), R308 (= R355), S333 (≠ G380), R334 (≠ S381), I335 (≠ L382), G336 (= G383), V337 (≠ F384), Q338 (≠ T385)
Sites not aligning to the query:
- binding (3R)-3-[(carboxymethyl)sulfanyl]nonanoic acid: 44, 46, 49
- binding flavin-adenine dinucleotide: 7, 9, 10, 11, 29, 30, 31, 32, 36, 37, 38, 40, 41, 42, 43, 44
6j38A Crystal structure of cmis2 (see paper)
29% identity, 72% coverage: 109:406/414 of query aligns to 58:360/368 of 6j38A
- binding flavin-adenine dinucleotide: A174 (≠ T219), A203 (= A252), W206 (≠ G255), G226 (= G274), G306 (= G353), R308 (= R355), S333 (≠ G380), R334 (≠ S381), I335 (≠ L382), G336 (= G383), V337 (≠ F384), Q338 (≠ T385)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 7, 9, 11, 29, 30, 31, 36, 37, 38, 41, 42, 43, 44
7cyxA Crystal strcuture of glycine oxidase from bacillus cereus atcc 14579 (see paper)
22% identity, 56% coverage: 180:410/414 of query aligns to 129:356/363 of 7cyxA
- binding flavin-adenine dinucleotide: V171 (= V223), G200 (≠ A252), G201 (= G253), W203 (≠ G255), G298 (= G353), R300 (= R355), P301 (= P356), Y326 (≠ G380), R327 (≠ S381), N328 (≠ L382), G329 (= G383), I330 (≠ F384)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 7, 8, 10, 11, 12, 30, 31, 32, 38, 39, 40, 43, 45, 46
6pxsA Crystal structure of iminodiacetate oxidase (idaa) from chelativorans sp. Bnc1 (see paper)
25% identity, 99% coverage: 1:408/414 of query aligns to 1:361/370 of 6pxsA
- binding flavin-adenine dinucleotide: G7 (= G7), G9 (= G9), I10 (≠ V10), D30 (≠ E30), N32 (≠ S48), H33 (≠ Y49), K36 (≠ V52), A37 (≠ S53), T38 (≠ P54), A40 (= A56), G41 (≠ D57), A42 (= A58), G43 (= G59), V44 (= V60), Y174 (≠ S222), A203 (= A252), W206 (≠ G255), I210 (≠ L259), Y250 (≠ V299), G305 (= G353), R307 (= R355), G333 (= G380), A334 (≠ S381), S335 (≠ L382), G336 (= G383), L337 (≠ F384), T338 (= T385)
Q5L2C2 Glycine oxidase; GO; GOX; GOXK; EC 1.4.3.19 from Geobacillus kaustophilus (strain HTA426)
23% identity, 60% coverage: 165:412/414 of query aligns to 125:367/377 of Q5L2C2
- V180 (≠ L205) binding
- R309 (= R355) binding
- 334:340 (vs. 379:385, 29% identical) binding
- R336 (≠ S381) binding
Sites not aligning to the query:
- 14:15 binding
- 34:35 binding
- 42:43 binding
- 47:49 binding
Query Sequence
>GFF2076 FitnessBrowser__psRCH2:GFF2076
MRVAVIGAGVIGLATAYSLVRQGHSVELIERRDDVALETSFANGGQLSYRYVSPLADAGV
PLQAIGWMLRGADAPLRFRPQASLHQWRWCLQFLLACRRSVNRRNAAHLLRLALHSQQIL
RSWREQDRLDGFAWRANGKLVIYRDQHSLHKGAAAIDDDSGQRLLDAAQCVDVEPALAPL
AASLHGGIYSPGDEVADCHLFCTELLQRLGASPRFRLHTGQSVSALRTEGKRVRAVVLGR
DDIAIDHLVVAAGTGSVGLLKPLGIDLPIYPLKGYSLTVGLADQDGVPQTNVTDYDNKVV
YARLDDQLRVAAMVDIAGWDAGLDQQRIATLQRLAGATFPGAGDYQRARQWAGLRPATPQ
GTPLLGRSGFDNLWLNVGHGSLGFTLACGSADLLTSVIGGSPPAVSLDGLSLPA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory